KEGG   Methanosarcina barkeri: Mbar_A2257Help
Entry
Mbar_A2257        CDS       T00271                                 

Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mba  Methanosarcina barkeri
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mbar_A2257
Enzymes [BR:mba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mbar_A2257
Peptidases [BR:mba01002]
 Cysteine Peptidases
  Family C44
   Mbar_A2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2865298..2866764)
Genome map
AA seq 488 aa AA seqDB search
MCGIAGAAGTPDTNEEVKRMLAALGHRGPDACGTYQAKGLSIGNTLLKITGDMLQPLVGK
GALVLNGEIFNFRELAAEQGIKTNSDTEVLFALIETKIKEGETPTNAIFSVLSRVNGDYA
LAYVLGNKLVLARDPVGVKPLFYSLEKEGKKPKLAFASEKKAFSSQKDQIKSFPPGRVMA
FDIRNGRLEEKSLTIDPPQERISEEHEASSRLKAALEKAVEIRLTKTSGIAFSGGIDSTF
LAALAKNIDPSISLYAVGLPDSHDLVQAQRAAEVAGMSDSLKTHTLSPEEIEAAIPNVIY
STESTDPMKIAIGLPLYFVAKTAKEDGKRVLLTGQGADELFGGYNRHKALLEHGPKVLDR
AIYTDLKNISTINLERDDMVTMANSVELRVPFLDKEVIKTGLAISPELKVLKRDSLYIRK
YILRKAADGLLPSELLWKEKKAIQYGTGVQKVLDRLAREAGFSKREGNHIEKYLKKVAEN
QGFDFIFR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagcaggagcagcaggaactcctgatacaaatgaagaagtaaaaagaatg
cttgcagccctggggcacagagggcccgatgcttgcggaacctatcaggccaaaggactg
agtataggaaatactctgcttaaaatcacaggcgacatgctccagcctctggttggaaaa
ggagctctggtactcaatggagaaattttcaatttcagggaacttgcagccgaacagggt
ataaaaaccaattcagacactgaagtactttttgctctcatagaaacaaagataaaggaa
ggagaaacgcctacaaatgcgattttttctgtactttccagagtaaatggagattacgct
ctggcctatgtcctgggtaacaaacttgtactcgctagagaccctgtaggagtcaaacct
ctgttttattccctggaaaaggaaggaaaaaaacctaaactcgcttttgcctccgaaaaa
aaagctttttccagccaaaaggaccagataaaatcttttccgcctggcagagttatggct
ttcgatatcagaaatggaaggcttgaagaaaaatcccttacaattgatcctccgcaagaa
agaatctcagaagaacacgaagcctcttcccgcctaaaggcggctcttgaaaaagctgta
gagataaggcttacaaaaacttcaggaattgcgttttcaggaggaattgacagtaccttt
ttagctgcccttgcaaaaaacattgatccctcaatttccctttatgctgtcgggcttcct
gattcccatgaccttgtccaggctcagcgtgcggctgaagttgctggcatgagtgattcc
ctcaagactcataccctttctcccgaagaaattgaggctgcaatcccgaacgtgatctat
tcgacggaatctacggaccctatgaaaattgcaattgggcttccactctattttgtagcg
aaaactgcaaaagaagacggaaaacgagtccttctcacaggtcagggtgcagacgaactt
tttggaggttataacaggcacaaggccctcctagagcatggtcctaaggtacttgacaga
gcgatctacacagaccttaaaaacatttcaactataaaccttgaaagggacgacatggtt
accatggccaactctgtagagctcagggtgccttttctggataaggaggtaataaaaaca
gggcttgcaatcagccctgaactcaaagtccttaaaagagatagcctgtatataagaaaa
tatatcctgagaaaagccgcagacggcctgcttccatcggaacttctctggaaagaaaag
aaagcaatccagtatgggacaggagttcaaaaggtacttgacaggcttgcccgcgaggca
ggattttcaaaaagggaaggaaaccatatcgagaaatacctaaaaaaggttgctgaaaac
caggggttcgatttcatattcaggtaa

DBGET integrated database retrieval system