KEGG   Methanosarcina barkeri: Mbar_A2903Help
Entry
Mbar_A2903        CDS       T00271                                 

Definition
cytidine kinase / inosine-guanosine kinase (EC:2.7.1.- 2.7.1.73)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mba  Methanosarcina barkeri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mbar_A2903
Enzymes [BR:mba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mbar_A2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3717317..3718216
Genome map
AA seq 299 aa AA seqDB search
MDRVISIVGHTALDYIVDVERIAGKNESSPVIDYEEYPGGGAANIAVAIAKLGGKSQLIS
PVGTDFVSSGYEKLLTEANVDLSRLYRIEDQKISKAFIFTDKEDNQTTYFYWGASSKFKK
LEPEPVDFVHLATADSVYNAKLAQIAGFVSFDPGQDLVTYSKENLELILAHTDILFANRH
EIRRVSEMTGKSFSELKAMIDIIVVTYDSKGSKIYTDKNEFLIPVISVQAADPTGAGDAY
RAGFLLALTRGYPLPTCGKIGSTVASFAVQARGCQTDLPTWEEMKARYEANFGRLEKEC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagagtaatttccatcgtagggcatactgcccttgattacattgtagatgttgaa
agaatcgcaggaaaaaatgagtcttctcctgtcattgactatgaagaatatcctggtgga
ggggctgccaatattgcggttgccattgcaaagttggggggaaagagccagctgatttcc
cctgtaggtacggattttgtaagttcaggatatgaaaaactccttacagaagcgaatgtt
gatctctcccgcctttatagaattgaggaccagaaaatttctaaagcctttattttcact
gataaggaagacaaccagacaacctatttttactggggagcttcttcaaaattcaagaaa
ttggaacccgaacctgtagattttgttcatcttgcaaccgctgactcggtgtataacgcg
aaactcgcacaaattgccggcttcgtctcctttgaccctggccaggatcttgttacgtat
tcaaaagaaaatcttgaactcatacttgctcacactgacatcctttttgcgaacagacac
gaaataaggcgagtttcagagatgaccggaaaaagcttctctgaactcaaggcgatgatc
gacatcattgtggtcacatacgattccaagggtagcaagatctatacagataaaaatgaa
tttttaattcctgtaatctctgtccaggctgcagatcccacaggagcaggagatgcttac
agggcaggtttccttctcgccctcacaagaggataccctcttcccacctgcggaaaaatt
gggtctacagtagcttcttttgctgtgcaggcacgaggttgccagacagaccttcccacc
tgggaagaaatgaaagcccgttatgaagccaattttggaaggcttgagaaagagtgctga

DBGET integrated database retrieval system