KEGG   Methanosarcina barkeri Fusaro: Mbar_A2903Help
Entry
Mbar_A2903        CDS       T00271                                 

Definition
(GenBank) cytidine kinase / inosine-guanosine kinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mbar_A2903
   00240 Pyrimidine metabolism
    Mbar_A2903
Enzymes [BR:mba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Mbar_A2903
    2.7.1.213  cytidine kinase
     Mbar_A2903
    2.7.1.-  
     Mbar_A2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:3717317..3718216
Genome map
AA seq 299 aa AA seqDB search
MDRVISIVGHTALDYIVDVERIAGKNESSPVIDYEEYPGGGAANIAVAIAKLGGKSQLIS
PVGTDFVSSGYEKLLTEANVDLSRLYRIEDQKISKAFIFTDKEDNQTTYFYWGASSKFKK
LEPEPVDFVHLATADSVYNAKLAQIAGFVSFDPGQDLVTYSKENLELILAHTDILFANRH
EIRRVSEMTGKSFSELKAMIDIIVVTYDSKGSKIYTDKNEFLIPVISVQAADPTGAGDAY
RAGFLLALTRGYPLPTCGKIGSTVASFAVQARGCQTDLPTWEEMKARYEANFGRLEKEC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagagtaatttccatcgtagggcatactgcccttgattacattgtagatgttgaa
agaatcgcaggaaaaaatgagtcttctcctgtcattgactatgaagaatatcctggtgga
ggggctgccaatattgcggttgccattgcaaagttggggggaaagagccagctgatttcc
cctgtaggtacggattttgtaagttcaggatatgaaaaactccttacagaagcgaatgtt
gatctctcccgcctttatagaattgaggaccagaaaatttctaaagcctttattttcact
gataaggaagacaaccagacaacctatttttactggggagcttcttcaaaattcaagaaa
ttggaacccgaacctgtagattttgttcatcttgcaaccgctgactcggtgtataacgcg
aaactcgcacaaattgccggcttcgtctcctttgaccctggccaggatcttgttacgtat
tcaaaagaaaatcttgaactcatacttgctcacactgacatcctttttgcgaacagacac
gaaataaggcgagtttcagagatgaccggaaaaagcttctctgaactcaaggcgatgatc
gacatcattgtggtcacatacgattccaagggtagcaagatctatacagataaaaatgaa
tttttaattcctgtaatctctgtccaggctgcagatcccacaggagcaggagatgcttac
agggcaggtttccttctcgccctcacaagaggataccctcttcccacctgcggaaaaatt
gggtctacagtagcttcttttgctgtgcaggcacgaggttgccagacagaccttcccacc
tgggaagaaatgaaagcccgttatgaagccaattttggaaggcttgagaaagagtgctga

DBGET integrated database retrieval system