KEGG   Methanosarcina barkeri Fusaro: Mbar_A2961Help
Entry
Mbar_A2961        CDS       T00271                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbar_A2961
   01230 Biosynthesis of amino acids
    Mbar_A2961
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2961
  Energy metabolism
   00680 Methane metabolism
    Mbar_A2961
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A2961
Enzymes [BR:mba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mbar_A2961
Exosome [BR:mba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mbar_A2961
  Exosomal proteins of melanoma cells
   Mbar_A2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3809811..3810527
Genome map
AA seq 238 aa AA seqDB search
MGHLILVRHGEPGLKPEERLAGWVDISLSRKGIEEALQCAAELEKFELDLAFASNLVRTQ
ETLFLILSGQKKTGVVVHESTGKKGNPGKTDWYSYPEKLGKKLIPIYFTPYLNERYYGKL
QGRKKQKMEEKYGAEKLASWRWNFQPGPPEGESLKVVYERAVPYFKEKILPAVKAGKNVL
ICAHQGSLRALVKYIEEISDEDIKEVKFSTGELAIYRYSEGKLIRENAEMSSEIKRNL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatcttatacttgtcaggcatggagaacctggattaaagccagaagaaaggctt
gccggctgggtggatatttctctcagcaggaaaggaatcgaagaggctcttcagtgtgca
gcagagcttgaaaagttcgaactggaccttgcttttgcctcaaaccttgtgcggacgcag
gaaacacttttcttaatattgtccgggcagaagaaaacaggggttgttgtccatgaaagt
acagggaagaaaggaaatccagggaaaacggactggtactcgtatcctgaaaagctcggt
aaaaaacttatcccgatttatttcacaccttatttaaacgagcgctactacggtaagctt
cagggcaggaaaaaacagaaaatggaagaaaaatacggagccgaaaaacttgcctcctgg
aggtggaactttcagccaggcccacctgaaggagaaagtctcaaagtcgtgtatgaacgt
gcagtaccttatttcaaagagaaaatcctgcctgccgtaaaggcaggaaaaaacgtgctg
atctgtgcccaccagggcagtctgagagctctggtcaaatatatagaagagatttccgac
gaggatatcaaggaagtcaaattttccacaggcgaacttgcgatatatcggtattcagaa
ggcaagctaatccgagaaaacgccgagatgagctctgagattaaaaggaacctctaa

DBGET integrated database retrieval system