KEGG   Methanosarcina barkeri: Mbar_A3188Help
Entry
Mbar_A3188        CDS       T00271                                 

Definition
AMP phosphorylase (EC:2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mba  Methanosarcina barkeri
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mbar_A3188
Enzymes [BR:mba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mbar_A3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4099508..4101028)
Genome map
AA seq 506 aa AA seqDB search
MQLKLEHFNIKIGQHKILLNIADAKELGVNPGDRVRIRGRESISAIADTTDDMVPPGTLG
VFSEVYEHFVNWDKPVEVVPAFRSKSASVIKKMMDKKPVVQEEIKTLVNDIVEENLSEIE
LSAFITSSYIHGMTDDEVEWLTRAMIESGDTIEFDTHPIMDKHSIGGVPGNKISLLVVPI
IAANGLLIPKTSSRAITGAGGTADLMEVLCPVEFSSQEVKEITEKVGGALVWGGATNIAP
ADDKLIRVEYPLSIDPYYQMLASIMAKKGAIGADNVVMDIPVGPSTKVPTVQEGQKLARD
LINLGHRLGMNVECAITYGSSPIGRKVGPSLEVREALKVLESMEGPNSLIEKSAALAGIL
LEMGGAAPRDRGKEIALETLRSGKALEKMKQIIEAQGGDPKITSADIQVGQYTADILASA
DGYVIEFDNKWIIEIARLAGAPNDKGAGVAIHKKMGESVKKGDPILTIYAEKEFKLETAL
ATAQRTNPIVVEGMLLKRIPGTYGFQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgaagttagaacattttaacataaaaatagggcagcacaagatattactaaat
attgccgatgcaaaggaactgggggttaacccaggcgatagggtccgtattcgtgggcgt
gaaagtatttctgcaattgcggatacaacggatgatatggttcctccaggcacgctgggc
gttttttccgaggtatatgagcactttgtgaactgggataaaccggtcgaagttgttccg
gcattccgttctaaatccgcatccgtgatcaagaaaatgatggataaaaaacctgttgtg
caggaagaaattaaaacactcgtaaacgatatagtggaagaaaatctcagtgaaatcgaa
ctttcggcatttataacatcttcttatattcacggaatgaccgatgatgaggtcgaatgg
cttacaagagctatgattgagagcggagacacgattgagtttgacactcatcctataatg
gacaaacactcgataggaggagtgcccggaaacaagatctccctccttgttgttcctatt
atcgctgcaaacgggcttcttattccgaagacgagttcaagggcgattacaggggcaggt
ggaactgctgaccttatggaagtgctctgtccggtagagttcagttcccaagaagtcaaa
gagataactgaaaaagtcgggggcgctcttgtctggggcggagccacaaatatagcgcct
gccgatgacaagctcataagggttgaataccctctctccattgatccttactaccagatg
ctcgcctcgattatggcaaaaaaaggagctatcggggccgacaatgtggtaatggacatt
ccggttgggccgagcacaaaagttccaactgttcaggaagggcaaaaacttgcaagagac
ctgattaaccttgggcacaggcttggaatgaacgttgaatgtgcaatcacctatggttcg
tctcctattggaagaaaagtaggaccttcactggaagtcagggaagctctgaaggtactg
gaaagtatggaaggtccgaacagccttattgaaaagagtgcggctctggcaggtatcctg
cttgagatggggggtgcggctccaagggaccgtggaaaagagattgcactggaaacacta
aggagcggaaaagcccttgagaagatgaaacagattattgaagcccagggcggtgatccg
aagattacctcggctgacatccaggtagggcaatatactgccgatattctcgcttctgcg
gacggatatgtcatcgagtttgacaataagtggataattgaaattgccaggctggcagga
gctcctaatgataaaggagccggggtcgctattcacaagaaaatgggagaatccgttaag
aagggagatcctatccttacgatctatgctgaaaaagagttcaaactagagaccgcattg
gcaacagcccagagaacaaacccgatagttgttgagggcatgcttcttaagagaattccc
ggaacctacgggttccagtaa

DBGET integrated database retrieval system