KEGG   Methanosarcina barkeri: Mbar_A3203Help
Entry
Mbar_A3203        CDS       T00271                                 

Definition
SSU ribosomal protein S6P modification protein
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mba  Methanosarcina barkeri
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mbar_A3203
Enzymes [BR:mba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mbar_A3203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4118661..4119650
Genome map
AA seq 329 aa AA seqDB search
MKKIGIVITDPEDWTARALTDASRKKDFSPFVLDLRDAEVSMNSPVWETKAEESNVVFKV
GDIKLSDLDAIIVRDVGAGAFEGVSFRFDILRELEDEGIPVVNSPEAIRNAANKYHASYL
LAKAGLPVPKTVAVQDMEAALKVISRFGDAVIKPVFGYKGKDIARVRNGEVRFSDRKIEP
SSPESTLNQLLEERGMLYIQEFIENPGRDIRAFVVDGKAIGAIYRKAASGSWVNNLSQGG
NADRCVLTEEQKEIAEKAALAVNTTFAGVDIIEGLTDEIPNEKIEIHSSQTEESPKILEV
NGTPSGKGIFDAWGINTAEYIIKYIEKIL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagggattgtcatcactgacccggaagactggacagccagggcacttact
gacgcatcgagaaaaaaagatttttctccttttgttctggatctcagggatgcagaggtc
agcatgaattcaccagtttgggaaacgaaagctgaagaatcaaacgtggtcttcaaagta
ggagatataaaactctctgaccttgacgcgataattgtaagagatgtgggtgcaggagct
ttcgaaggcgtgtctttcaggtttgatatcctgcgtgaactggaagacgaaggaatccct
gttgttaactcaccagaagctatccggaatgctgcaaataaataccatgcttcctatctt
ctggcaaaggccggactgcctgtaccaaaaaccgtagctgtgcaggatatggaagccgcc
ctaaaggtaatatcaagatttggagacgccgtcattaagcctgtttttggatataaagga
aaggatattgcaagagtaaggaacggcgaagttcggttttcggatagaaaaatagaaccc
tcatcaccggaatcaactctcaatcagttgcttgaagaaagaggtatgctgtatatccag
gagttcatagagaatccgggaagagatatcagagcctttgttgttgacgggaaggctatt
ggagcaatttaccgtaaagcagcctctggctcctgggtcaataacctgagccagggagga
aatgcagaccggtgtgtgctcacggaagaacaaaaagaaattgctgagaaggctgccctg
gcagtaaacacgacttttgcaggtgttgatattatagaagggttgactgatgagattcct
aatgaaaaaattgagattcattctagccaaactgaggagagccctaaaattcttgaagtc
aatggaacaccatcaggaaaaggtatttttgatgcctggggaataaatacggcagagtat
attataaaatacatcgaaaaaattttatga

DBGET integrated database retrieval system