KEGG   Methanosarcina barkeri Fusaro: Mbar_A3503Help
Entry
Mbar_A3503        CDS       T00271                                 

Definition
(GenBank) tryptophan synthase, subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00260  Glycine, serine and threonine metabolism
mba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01130  Biosynthesis of antibiotics
mba01230  Biosynthesis of amino acids
Module
mba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A3503
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbar_A3503
Enzymes [BR:mba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbar_A3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAZ72374
JGI: MbarA3503
UniProt: Q465R8
Position
1:4492772..4494070
Genome map
AA seq 432 aa AA seqDB search
MEQTKIILDENEMPKQWYNVLSDLSSPIEPPLDPRTREPISPEALEPIFPKGLIKQEMSS
ERFIDIPEEILEIYRLWRPSPLYRAHRLEKLLKTPAKIYYKNEGVSPAGSHKTNTSIAQA
YYNMKEGTERITTETGAGQWGSALALACNYFDLECKVYMVRSSFYQKPYRKSMITIWGGN
VVPSPSEDTEFGRKILKEQPETPGSLGIAISEAVEDAIAHDSTKYSLGSVLNHVMLHQTI
IGAECKKQLEQVETYPDIVIGCCGGGSNLAGISLEFIKDKIEGKRNPRVIAVEPSACPSL
TKGEYRYDFGDTAEMTPLLKMYTLGHKHVPPAIHAGGLRYHGDSPIISKLCDEGFIEAVS
YDQYPVFDAAVQFARTEGIVPAPESAHAIRCAIDEAIKCKQTGEEKTILFNLSGHGHFDM
SSYDKYFNKELA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaccaagattatccttgacgagaatgaaatgcctaaacagtggtataacgtc
ctttcggacttatcttctcctatcgagccgcctcttgatccaagaacccgggagcctata
agccctgaagcccttgaacctatttttccaaaaggtcttatcaagcaggaaatgagcagt
gaaaggtttattgatatccctgaagagatacttgaaatttacagactctggagacccagt
cctctttacagggctcacaggctggaaaaacttctcaaaacccctgcaaagatatactat
aaaaatgaaggggtaagccccgcaggcagccataagacaaatacctcaattgcccaggcc
tactataatatgaaagaaggaaccgagaggatcacaaccgaaacaggggcagggcagtgg
ggaagtgcattggctcttgcctgcaattattttgatctcgaatgtaaagtctatatggtc
cgttccagtttttaccagaaaccttaccggaaatccatgataacaatctggggaggaaat
gttgtgccctcgccaagtgaagataccgaattcgggagaaagattctgaaggagcagccg
gaaacaccgggaagcctgggaatagcaatcagtgaagccgtagaggatgcaatcgcacac
gatagcactaaatattcccttggaagcgtgctcaaccatgttatgctccaccagacgata
atcggggccgaatgcaagaagcagcttgaacaagttgaaacctatcctgatatagttata
ggctgctgcggaggaggaagcaacctcgcgggaatatctcttgagtttattaaagacaag
attgaaggaaagaggaatccaagagtaattgcagtcgagccctcagcctgcccgtccctg
accaaaggagaatacaggtacgacttcggagacactgcggaaatgaccccacttcttaaa
atgtataccctgggacacaaacatgtgcctcctgccatccacgcaggcggactccgttac
catggtgactccccaatcataagtaaactctgtgatgaagggtttatcgaagccgtttca
tatgatcagtatcctgtatttgatgccgctgtgcagttcgcacggactgaaggcatagtc
cctgctccggaatccgcgcatgctatccgctgtgcaatcgacgaagctatcaaatgcaag
caaaccggagaagaaaaaacaattctcttcaacctgagtggacacggacatttcgacatg
agttcatatgacaaatatttcaacaaagaacttgcctga

DBGET integrated database retrieval system