KEGG   Methanosarcina barkeri Fusaro: Mbar_A3503Help
Entry
Mbar_A3503        CDS       T00271                                 

Definition
(GenBank) tryptophan synthase, subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbar_A3503
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A3503
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbar_A3503
Enzymes [BR:mba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbar_A3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:4492772..4494070
Genome map
AA seq 432 aa AA seqDB search
MEQTKIILDENEMPKQWYNVLSDLSSPIEPPLDPRTREPISPEALEPIFPKGLIKQEMSS
ERFIDIPEEILEIYRLWRPSPLYRAHRLEKLLKTPAKIYYKNEGVSPAGSHKTNTSIAQA
YYNMKEGTERITTETGAGQWGSALALACNYFDLECKVYMVRSSFYQKPYRKSMITIWGGN
VVPSPSEDTEFGRKILKEQPETPGSLGIAISEAVEDAIAHDSTKYSLGSVLNHVMLHQTI
IGAECKKQLEQVETYPDIVIGCCGGGSNLAGISLEFIKDKIEGKRNPRVIAVEPSACPSL
TKGEYRYDFGDTAEMTPLLKMYTLGHKHVPPAIHAGGLRYHGDSPIISKLCDEGFIEAVS
YDQYPVFDAAVQFARTEGIVPAPESAHAIRCAIDEAIKCKQTGEEKTILFNLSGHGHFDM
SSYDKYFNKELA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaccaagattatccttgacgagaatgaaatgcctaaacagtggtataacgtc
ctttcggacttatcttctcctatcgagccgcctcttgatccaagaacccgggagcctata
agccctgaagcccttgaacctatttttccaaaaggtcttatcaagcaggaaatgagcagt
gaaaggtttattgatatccctgaagagatacttgaaatttacagactctggagacccagt
cctctttacagggctcacaggctggaaaaacttctcaaaacccctgcaaagatatactat
aaaaatgaaggggtaagccccgcaggcagccataagacaaatacctcaattgcccaggcc
tactataatatgaaagaaggaaccgagaggatcacaaccgaaacaggggcagggcagtgg
ggaagtgcattggctcttgcctgcaattattttgatctcgaatgtaaagtctatatggtc
cgttccagtttttaccagaaaccttaccggaaatccatgataacaatctggggaggaaat
gttgtgccctcgccaagtgaagataccgaattcgggagaaagattctgaaggagcagccg
gaaacaccgggaagcctgggaatagcaatcagtgaagccgtagaggatgcaatcgcacac
gatagcactaaatattcccttggaagcgtgctcaaccatgttatgctccaccagacgata
atcggggccgaatgcaagaagcagcttgaacaagttgaaacctatcctgatatagttata
ggctgctgcggaggaggaagcaacctcgcgggaatatctcttgagtttattaaagacaag
attgaaggaaagaggaatccaagagtaattgcagtcgagccctcagcctgcccgtccctg
accaaaggagaatacaggtacgacttcggagacactgcggaaatgaccccacttcttaaa
atgtataccctgggacacaaacatgtgcctcctgccatccacgcaggcggactccgttac
catggtgactccccaatcataagtaaactctgtgatgaagggtttatcgaagccgtttca
tatgatcagtatcctgtatttgatgccgctgtgcagttcgcacggactgaaggcatagtc
cctgctccggaatccgcgcatgctatccgctgtgcaatcgacgaagctatcaaatgcaag
caaaccggagaagaaaaaacaattctcttcaacctgagtggacacggacatttcgacatg
agttcatatgacaaatatttcaacaaagaacttgcctga

DBGET integrated database retrieval system