KEGG   Methanosarcina barkeri Fusaro: Mbar_A3564Help
Entry
Mbar_A3564        CDS       T00271                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01200  Carbon metabolism
mba01230  Biosynthesis of amino acids
Module
mba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A3564
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mbar_A3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C NAD_binding_3 GFO_IDH_MocA TrkA_N IlvN Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AAZ72433
JGI: MbarA3564
UniProt: Q465K9
Position
1:4575034..4576050
Genome map
AA seq 338 aa AA seqDB search
MAKAKIAVNGYGTIGKRVADAVRAQDDMEVVGISKTKPNYEAAVAHRLGYDIYAPAANLE
AFEKAGMPAAGSIEEMLEKADLVVDCTPGGIGEKNKPIYEKVGIKAIWQGGESHPIAGFS
FNAESNYEQAVGRDLTRVVSCNTTALCRAISTIDRELGVNKVRASLSRRAVDPNEIKKGP
VDAIVLNPVKLPSHHGPDVRSVLPHINITTAAIKVPTTLMHVHTVNMEVNKDCTAEDVKN
IFGSQSRIRLVGQGITSTAEIIEFARDIGRPRHDMWELCIWPESITVTDKELYFFHAVHQ
ESIVVPENVDAIRAMMELESDGAKSIEKTNKAIGLYNK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaaaaattgcggtaaacggttacggaactataggaaaaagggttgcagac
gccgttagggctcaggacgatatggaagttgtcggaatttccaagacaaaaccgaattat
gaggcagcagtggcacatcggctaggatatgacatatatgccccagctgcaaatctcgaa
gcttttgagaaagcaggaatgccagcagctggaagtattgaagagatgctagagaaagct
gacctggttgtggactgcactccagggggaattggggaaaaaaataagcctatttatgag
aaagtagggataaaggcaatctggcagggaggagagagtcaccccattgcgggtttttcc
tttaatgcagagagtaattacgaacaggctgtaggccgcgacctgacaagagttgtctcg
tgtaatactacagcactttgcagggctatttcaactatagacagagaactcggagtaaat
aaggtaagagccagtctctcaagaagggcagttgatcccaacgaaattaaaaaaggacct
gttgatgcaatcgtacttaacccggttaaacttccgtctcaccacggaccggacgtaagg
agtgtgcttccacacattaacataacgactgcagctataaaagtcccaacgactctgatg
catgtgcacactgtaaatatggaagtcaataaggattgcactgcagaagacgttaagaat
atctttggttctcagtccaggatccgtttagtagggcaggggattacttcaacagctgag
ataattgaatttgcacgggatattgggcgccccagacacgatatgtgggagctctgtatc
tggcctgaatctattacagtgaccgataaagagctttacttcttccatgctgtccatcag
gagtctatcgtcgttccagagaacgtggatgctataagagctatgatggaacttgaaagc
gacggtgcaaagtcaattgaaaagacaaataaggctattggactgtataacaagtaa

DBGET integrated database retrieval system