KEGG   Methanosarcina barkeri: Mbar_A3564Help
Entry
Mbar_A3564        CDS       T00271                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mba  Methanosarcina barkeri
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbar_A3564
   01230 Biosynthesis of amino acids
    Mbar_A3564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A3564
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mbar_A3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4575034..4576050
Genome map
AA seq 338 aa AA seqDB search
MAKAKIAVNGYGTIGKRVADAVRAQDDMEVVGISKTKPNYEAAVAHRLGYDIYAPAANLE
AFEKAGMPAAGSIEEMLEKADLVVDCTPGGIGEKNKPIYEKVGIKAIWQGGESHPIAGFS
FNAESNYEQAVGRDLTRVVSCNTTALCRAISTIDRELGVNKVRASLSRRAVDPNEIKKGP
VDAIVLNPVKLPSHHGPDVRSVLPHINITTAAIKVPTTLMHVHTVNMEVNKDCTAEDVKN
IFGSQSRIRLVGQGITSTAEIIEFARDIGRPRHDMWELCIWPESITVTDKELYFFHAVHQ
ESIVVPENVDAIRAMMELESDGAKSIEKTNKAIGLYNK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaaaaattgcggtaaacggttacggaactataggaaaaagggttgcagac
gccgttagggctcaggacgatatggaagttgtcggaatttccaagacaaaaccgaattat
gaggcagcagtggcacatcggctaggatatgacatatatgccccagctgcaaatctcgaa
gcttttgagaaagcaggaatgccagcagctggaagtattgaagagatgctagagaaagct
gacctggttgtggactgcactccagggggaattggggaaaaaaataagcctatttatgag
aaagtagggataaaggcaatctggcagggaggagagagtcaccccattgcgggtttttcc
tttaatgcagagagtaattacgaacaggctgtaggccgcgacctgacaagagttgtctcg
tgtaatactacagcactttgcagggctatttcaactatagacagagaactcggagtaaat
aaggtaagagccagtctctcaagaagggcagttgatcccaacgaaattaaaaaaggacct
gttgatgcaatcgtacttaacccggttaaacttccgtctcaccacggaccggacgtaagg
agtgtgcttccacacattaacataacgactgcagctataaaagtcccaacgactctgatg
catgtgcacactgtaaatatggaagtcaataaggattgcactgcagaagacgttaagaat
atctttggttctcagtccaggatccgtttagtagggcaggggattacttcaacagctgag
ataattgaatttgcacgggatattgggcgccccagacacgatatgtgggagctctgtatc
tggcctgaatctattacagtgaccgataaagagctttacttcttccatgctgtccatcag
gagtctatcgtcgttccagagaacgtggatgctataagagctatgatggaacttgaaagc
gacggtgcaaagtcaattgaaaagacaaataaggctattggactgtataacaagtaa

DBGET integrated database retrieval system