KEGG   Methanosarcina barkeri Fusaro: Mbar_A3623Help
Entry
Mbar_A3623        CDS       T00271                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbar_A3623
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A3623
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbar_A3623
Enzymes [BR:mba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbar_A3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:4656725..4657516
Genome map
AA seq 263 aa AA seqDB search
MERQKISEKFSELREKKEGALICYVMAGDPSAEKTGEIVKALVNGGADIIELGFPFSDPV
ADGPTIQVAGQRSLAAGMDTQRYFELIKNLDVGIPLVCMTYYNPVFRYGVEKFVEKAADA
GISGLIVPDIPVEEAADLKNSCEKHGLDLIFLIAPTTTEGRVQKILERGSGFLYLVSRLG
VTGAREDVSSSTRELLSRVETGLPKAVGFGISTGEQAAEVRDAGADAVIVGSAFVKIIDE
GKDVNERLEALAKELKSGIKRAS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcaaaaaatctccgaaaaattctccgaactcagggaaaaaaaggaaggtgct
ctgatctgttacgtaatggcaggagacccgtccgcagaaaaaaccggggaaattgtaaaa
gctctggtgaacggaggtgcggatatcatagaactaggttttcccttctcagaccctgta
gcggacggcccgacaatccaggtggcaggacagaggtcacttgcagcaggaatggataca
cagcgttattttgagcttattaaaaacctggatgttggaattccacttgtttgcatgacc
tattacaaccctgtattcaggtacggagtggaaaaatttgtagaaaaggctgcagatgcc
ggaataagcggactgatagtacccgatatcccggttgaagaagcggctgacctgaaaaat
agctgtgaaaagcacgggcttgaccttatctttctaattgcacccacaacaaccgaggga
agagtccagaaaatcctggaaagaggttcaggtttcctttaccttgtctcgaggcttggg
gtcactggagccagggaagatgtctcatcctctaccagagagctactttccagagtagaa
accgggcttcctaaggctgtgggatttggaatctcaacaggagagcaagctgcagaagtt
agagacgccggagcagatgcagttatagtcggctcggcttttgttaagattatagatgaa
ggaaaagacgtaaacgaaaggctggaagcccttgcaaaggaactcaaatccggcatcaaa
agagccagttaa

DBGET integrated database retrieval system