KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0175Help
Entry
BCG_0175          CDS       T00463                                 

Definition
oxidoreductase (EC:1.-.-.-)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Brite
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BCG_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
195724..196746
Genome map
AA seq 340 aa AA seqDB search
MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRSIDDLPLTRFHGDVFD
TATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLDVATDASLRRFVFTSSY
ATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDAGLPAVAMCVSTTYGGGD
WGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILAAERGRNGERYLISERMMP
LQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTGKDTELSLASVRMMRSEADV
DHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccaagctggtcattggcgcgaacggcttcctgggttcgcacgtgactcgc
cagctcgtcgccgactgcgcgccgcagaaaggtgaggtacgcgcgatggtgcgacccgct
gccaacacccggagcatcgacgatctaccgctcacccgattccacggcgacgtcttcgac
accgccaccgtggccgaggcgatggccggctgcgacgacgtctactactgtgtggtcgac
acccgcgcctggttgcgcgatccctccccgctgtttcgcaccaatgtggcaggcctgcgc
aacgtcctcgatgtggccacagacgccagcctgcgcaggttcgtcttcaccagcagttat
gcgacggtgggtcgtcggcgtggacacgtggcgaccgaagaagaccgggtggatacccgc
aaggtgactccttacgtgcggtcccgggtggcggccgaggatctggtgctgcaatacgcg
cacgacgcaggtctgcccgccgtcgcgatgtgtgtgtcgacaacctacggcggcggcgac
tggggccgcaccccacacggcgccttcatcgcgggcgcggtgttcggcaggctgcctttc
acgatgcgcggcatccggctggaggcggtgggtgtcgacgatgctgcgagggcgctgatc
ttggcggccgaacgcgggcgcaacggcgaacggtacctcatctccgaacgcatgatgccg
ttgcaagaagtggtgcggatcgccgcggatgaggccggtgtcccgccgccacgatggtcg
atctcggtgccggtgctttacgccctgggtgcgttgggcagtttgcgagcccgactcacg
ggcaaagataccgaactcagcctggcgtcggtgcgcatgatgcgttccgaggccgatgtc
gaccacggcaaggccgtccgcgagttgggttggcagccacgtccggtggaggagtcgatc
cgggaggccgcccggttctgggcggcgatgcgcaccgtcgggaaggaccccgcggcctcg
tga

DBGET integrated database retrieval system