KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0275Help
Entry
BCG_0275          CDS       T00463                                 

Gene name
lpqI
Definition
lipoprotein lpqI
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mbb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mbb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
315216..316382
Genome map
AA seq 388 aa AA seqDB search
MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCAEPAGIPALLS
PRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDGALAEIVAGGGPLPLAV
SVDEEGGRLSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRGRQMRKLGITIDFAPVVD
VTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGV
TTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYG
APPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPAVLDRLEQALR
AGELPMSAVDRSVVRVATMKGPNPGCGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccacgcacactggcgatactcgctgcggcagcagcgttggtggtggcctgc
agccatggcggcacacccaccggatcgtcgacgacctccggcgcgtcgcccgcaactccg
gtagccgttcccgtgccccggagctgcgccgagccggcggggatcccggcgctgctgtcc
ccccgtgacaagctggcccagctgctggtggtcggcgtgcgagatgctgcggacgcccaa
gccgtggtcaccaactaccacgtcggcggcatcctcatcggcagcgacaccgacctgacg
atttttgacggcgcgctggccgagatcgttgccggcgggggtccgctgccgctggcggtg
agtgtcgacgaggaaggcgggcggttgtcccggttgaggtcgctgatcggcggtacgggg
ccgtcggcccgcgaactggcacaaacccgaaccgtccagcaggtgcgcgacttggctcga
gaccgcggccggcagatgagaaagctgggtatcaccatcgacttcgccccggtggtcgac
gtcaccgacgccccggatgacacggtgatcggggaccggtcgttcggctcggatccggct
acggtcaccgcgtatgccggggcgtacgcgcagggtctgcgcgatgccggggtgctgccg
gtgctcaagcatttccccggtcacgggcgtggctcgggtgattcgcacaacgggggtgtc
acgacaccaccgcttgatgacctggtgggcgatgacctggtgccctaccgaacgctggtg
acccaggcgccggtcggtgtgatggtgggtcatctgcaggttcctgggttgaccggctcc
gagccggccagtctgagcaaggccgcggtgaacctgctgcgcaccggcacgggatacggc
gcaccgccgttcgatggtccagtgttcagcgacgacctctctggtatggccgcgatctca
gaccggtttggcgtcagcgaggcggtgttgcgcaccttgcaagccggtgccgatatcgca
ctgtgggttaccaccaaagaggtgcccgcggtgctggaccgcctggaacaggcgctgcgc
gccggtgaattgccgatgtcggcggtcgaccggtcggtggtgcgggtggcgaccatgaag
gggcccaacccggggtgtggccgttag

DBGET integrated database retrieval system