KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0298cHelp
Entry
BCG_0298c         CDS       T00463                                 

Definition
(GenBank) Posible transcriptional regulatory protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00860  Porphyrin and chlorophyll metabolism
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCG_0298c
Enzymes [BR:mbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BCG_0298c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CAL70282
UniProt: A0A0H3M7M0
Position
complement(339545..340690)
Genome map
AA seq 381 aa AA seqDB search
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL
IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE
WSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR
WKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM
CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN
IVATVVKRGYRLAVDSRHDDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcacactcggcgccactgaccggctaccggatcgcggtgacatccgctcgc
cgcgccgaagagctgtgcgcattgcttcgccgccagggcgccgaggtctgtagtgcccca
gcgatcaagatgatcgcgcttcccgacgacgatgaactgcagaacaacaccgaggcgttg
atcgccgacccgcctgacattctggtcgcccacaccggcatcggatttcgcggctggttg
gccgcggccgaggggtgggggctggccaacgagctcctggaatcgttgtcgtcggcccgg
atcatctcccgcggaccaaaggcaactggtgcgctgcgtgccgccggcctgcgtgaagag
tggtcccccgactctgaatcgtcgcatgaagtgctggaatatctgctcgaatcgggggtg
tcccgtacgcgtattgccgtccagctgcacggtgccgccgacagctgggacccgtttccg
gaatttctgggcgggttacgtttcgccggcgcgcaagtggtgccgatccgggtttaccgg
tggaagccggcgccactaggcggcgtgttcgaccatttagtcaccgggatcgcgcgacga
caattcgacgcggtcaccttcacgtcggcacctgccgcagccgcggtgctagaacgcagc
cgtgaattggatatcgaggaccaactgttggctgcgctgcgtaccgacgtgcacgcgatg
tgtgtcggcccggtaacttcgcggccgttgatccgaaagggcgtcccgacgtcggctccc
gagcgaatgcggttgggagccttagcccgccacattgccgaggagctgccgctgctgggt
tcgtgcacgttcaaagcagccggccacgtgatcgagatccgtggaacctctgtgctggtg
gatgattcggtgaagccactatcgccgtccggaatggcgattttgcgcgcgttggtacat
cgccccggcggcgtcgtctctcgtggcgacttgctacgcgtcctacccggcgacggcagc
gacacccacgccgtggacaccgccgtactgcggctacgaacggctctgggcgacaagaac
atcgtggcaacagtggtgaaacgtggctaccgtctcgccgttgacagccggcacgatgac
gtatga

DBGET integrated database retrieval system