KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0699Help
Entry
BCG_0699          CDS       T00463                                 

Definition
(GenBank) Possible sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00010  Glycolysis / Gluconeogenesis
mbb00052  Galactose metabolism
mbb00500  Starch and sucrose metabolism
mbb00520  Amino sugar and nucleotide sugar metabolism
mbb00521  Streptomycin biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
Module
mbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mbb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_0699
   00052 Galactose metabolism
    BCG_0699
   00500 Starch and sucrose metabolism
    BCG_0699
   00520 Amino sugar and nucleotide sugar metabolism
    BCG_0699
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCG_0699
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCG_0699
Enzymes [BR:mbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCG_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CAL70685
UniProt: A0A0H3M8K2
Position
778446..779354
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaacatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacggctggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system