KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0911Help
Entry
BCG_0911          CDS       T00463                                 

Gene name
fadA
Definition
(GenBank) Possible acyl-CoA thiolase fadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG_0911 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BCG_0911 (fadA)
   00640 Propanoate metabolism
    BCG_0911 (fadA)
   00650 Butanoate metabolism
    BCG_0911 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_0911 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BCG_0911 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_0911 (fadA)
   00310 Lysine degradation
    BCG_0911 (fadA)
   00380 Tryptophan metabolism
    BCG_0911 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_0911 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_0911 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCG_0911 (fadA)
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG_0911 (fadA)
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG_0911 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
985582..986793
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagggcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system