KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0912Help
Entry
BCG_0912          CDS       T00463                                 

Gene name
fadB
Definition
(GenBank) Probable fatty oxidation protein fadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00071  Fatty acid degradation
mbb00280  Valine, leucine and isoleucine degradation
mbb00281  Geraniol degradation
mbb00310  Lysine degradation
mbb00362  Benzoate degradation
mbb00380  Tryptophan metabolism
mbb00410  beta-Alanine metabolism
mbb00640  Propanoate metabolism
mbb00650  Butanoate metabolism
mbb00903  Limonene and pinene degradation
mbb00930  Caprolactam degradation
mbb01040  Biosynthesis of unsaturated fatty acids
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
mbb01212  Fatty acid metabolism
Module
mbb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCG_0912 (fadB)
   00650 Butanoate metabolism
    BCG_0912 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_0912 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BCG_0912 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_0912 (fadB)
   00310 Lysine degradation
    BCG_0912 (fadB)
   00380 Tryptophan metabolism
    BCG_0912 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCG_0912 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCG_0912 (fadB)
   00281 Geraniol degradation
    BCG_0912 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_0912 (fadB)
   00930 Caprolactam degradation
    BCG_0912 (fadB)
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BCG_0912 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCG_0912 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BCG_0912 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored adh_short_C2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAL70898
UniProt: A0A0H3M3A7
Position
986798..988960
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARTRELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaatccagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ttgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggtctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgccaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgttgatttcgtgatcgaggcggtttttgaaaaccaggagctcaagcac
aaggtgttcggcgagatcgaagacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagactttatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttctgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttctatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacttagagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgcctcgacgagggggtgctgacgtcgacggcc
gacgccaacatcggctcgatcatgggcatcggcttcccgccgtggacaggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
acccgcgagctggcggccgcctacggcgaccgcttcctgccgccggagtcgctgctaagc
tga

DBGET integrated database retrieval system