KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1068Help
Entry
BCG_1068          CDS       T00463                                 

Gene name
ispE
Definition
(GenBank) Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase ISPE (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00900  Terpenoid backbone biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01130  Biosynthesis of antibiotics
Module
mbb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_1068 (ispE)
Enzymes [BR:mbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCG_1068 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAL71055
UniProt: A1KHE9
Position
1160680..1161600
Genome map
AA seq 306 aa AA seqDB search
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEG
ADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLL
TSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARA
LRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
SAPTEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgggtcggtcaccgttcgggtgcccggaaaggtcaacctctatctggcggtc
ggcgatcgccgcgaggacggctatcacgagctgaccacggtatttcatgccgtctcgctg
gtcgacgaggtaaccgttcgtaacgctgatgtgctctcgctcgagttggtcggcgagggg
gccgaccagctgccgaccgacgaacgcaatctcgcctggcaggcggccgagctgatggcc
gaacacgtgggccgggcgccggacgtctcgatcatgatcgacaaatccattccggtcgcc
ggcggcatggccggtggcagcgcggacgctgcggcggtcctggttgcgatgaactcgttg
tgggaactcaatgtgccccgccgcgacctgcgcatgctcgccgcgcggctaggcagcgat
gtgccgtttgccctgcatggtggtaccgcgctggggacgggtcgcggcgaggagttggcc
accgtgttatcccgcaacaccttccactgggtcctggcgttcgccgacagcgggttgctc
acctccgcggtgtacaacgagctcgaccggctcagggaggtgggggatccgccccggctt
ggtgagcccgggccggttctggctgccttagctgcgggtgatccggatcagctggcgccg
ttgctgggtaatgaaatgcaagcggccgcggtgagcctggacccggcgctggctcgtgcg
ttacgcgccggtgtggaggccggcgcgctcgcaggcatcgtgtccggttcgggtcccacg
tgtgccttcctgtgcacctcggcgagctcggcgatcgatgtcggcgcgcagctgtcgggg
gcgggagtttgtcgcaccgttcgagtcgccaccgggccggtacccggcgcccgcgtggtg
tctgcgccgaccgaagtgtga

DBGET integrated database retrieval system