KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1132cHelp
Entry
BCG_1132c         CDS       T00463                                 

Gene name
fadA3
Definition
(GenBank) Probable beta-ketoacyl CoA thiolase fadA3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG_1132c (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    BCG_1132c (fadA3)
   00640 Propanoate metabolism
    BCG_1132c (fadA3)
   00650 Butanoate metabolism
    BCG_1132c (fadA3)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_1132c (fadA3)
   00072 Synthesis and degradation of ketone bodies
    BCG_1132c (fadA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_1132c (fadA3)
   00310 Lysine degradation
    BCG_1132c (fadA3)
   00380 Tryptophan metabolism
    BCG_1132c (fadA3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_1132c (fadA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_1132c (fadA3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCG_1132c (fadA3)
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG_1132c (fadA3)
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG_1132c (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1229455..1230672)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMMGCGLP
GGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFAKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRTDQKLPDIYIAMGQTAENVA
IMTGISREEQDRWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKV
SELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALERAGMAITDIDLVEINEAFAVQVLGSARELGIDEDKLNISGGAIALGH
PFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctgtcatcgtctcgactgcccgctcgccgattggccgggccatgaaagga
tcgctggtcggcatgcggcccgacgacctggccgtccagatggtgcgcgccgcgctcgac
aaggttccggcactgaacccccatcagatcgacgacctcatgatgggctgtggcctgcca
ggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcgctcggctatgacttc
ctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcagaccacccggatggcc
ttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggcgtggaaaccgtc
tcccggttcgccaagggaaactccgactcctggccggacaccaagaacccgctgttcgac
ggggctcaggaacgttcggccgcggcagccgccggcgccgacgaatggcacgatccccgc
accgatcagaagctgccggacatctatattgcgatgggccagaccgcggaaaacgtcgcc
atcatgaccggcatcagccgcgaagaacaggaccgctggggcgtgcgcagccagaaccgg
gccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacgccggtcacccttccg
gacggcaccacggtcagcaccgacgacggcccgcgaccgggtaccacctacgaaaaggtc
agcgagctcaagccggctttccggccgaatggcaccgtgaccgcggggaatgcctgtccg
ctcaacgacggggccgccgcggtggtgatcaccagcgacaccaaggccaaggaattaggc
ttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctgtccccggagatcatg
ggcttagggccgatcgaggcgtccaagaaggcgctggaaagagccgggatggcgatcacc
gacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtcctgggctcggcgcgc
gagctgggcatcgacgaggacaagctcaacatctcaggtggcgcgatcgccctaggtcac
ccgttcggtatgacgggtgcgcgcatcaccaccacgctgttgaacaacctgcagacctac
gacaagacgttcggtctggaaaccatgtgtgtcggtggcggccagggcatggcgatggtg
atcgagcgcctcgcgtga

DBGET integrated database retrieval system