KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1150Help
Entry
BCG_1150          CDS       T00463                                 

Gene name
celA2b
Definition
cellulase celA2b (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCG_1150 (celA2b)
Enzymes [BR:mbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BCG_1150 (celA2b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1247024..1247479
Genome map
AA seq 151 aa AA seqDB search
MGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGS
IQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPIT
DSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccaacctgcctactgaggtgggccagattttgtcggcgccgaccagcatcgac
tacaactacccgacgaccggggtatgggacgcctcctacgacatctgcctggattccaca
cccaagacgaccggggtcaaccagcaggagatcatgatctggttcaaccaccagggctcc
attcagccggtcggctccccggtgggcaacaccaccatcgagggcaagaacttcgtggtg
tgggatggcagcaacggcatgaacaacgcgatggcctatgtcgcgaccgagccgatcgag
gtctggagcttcgacgtgatgagtttcgtcgaccacaccgccaccatggagccgatcacc
gactcgtggtacctcacgagcatccgggccggcttggagccctggagcgacggtgtgggt
ctgggggtcgattcgttctcggcgaaagtcaactaa

DBGET integrated database retrieval system