KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1262Help
Entry
BCG_1262          CDS       T00463                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mbb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1374979..1376043
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALIDIPSESRKEARIADEVEAALRAQASGFEIIRNGNAVLARTKLNR
SSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLAEPTHDLTLV
FYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTLRVVLSVTGTRAH
SARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAVRVAGGVAGNVIPDAASV
TINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAAAGALPGLSEPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVGNITAAVDLLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgatcgaattgaccgcggcgctgattgacatccccagc
gagtcgaggaaggaggcacgcatcgccgacgaggtggaagcggcgttgcgcgctcaggca
tcggggttcgagatcatccgcaacggcaacgcggtgctggcgcgtacaaagctgaaccgg
tcctcgcgggtgctgttggccggacacctggacaccgtgccagtggccggcaacctgcct
agccgccgcgagaacgaccagctgcacggctgcggcgcagccgacatgaaatccggcgac
gcggtcttccttcatctggccgctacactggccgaaccgacgcacgatctaacactggtg
ttctacgactgcgaggaaatcgattcggcggcaaacggtttaggccgcatccagcgcgag
ctgccggactggctatccgcggatgtagccatcttgggtgagcccaccgccggctgcatc
gaggctggttgccagggcacgttgcgtgtcgtcctcagcgtgaccggaactcgcgcgcat
tcagcgcgttcgtggttgggtgacaacgcaatccacaagttgggtgctgtgctggaccgg
ttggccgtctaccgggcacgcagcgtcgacatcgacggttgcacctatcgggagggcctc
tcggcggtgcgcgtagcaggcggcgtcgccggcaacgtgatccctgacgcggcctcggtc
acgatcaactaccgctttgcccccgaccggtcggtggccgcggcattgcaacatgtccat
gacgtgttcgacgggctcgacgtgcagatcgagcagacggacgccgcggccggtgcgctg
cctggcctgtccgagcccgcggccaaggcgctggtcgaggccgccggcgggcaggtccgg
gccaagtatggctggactgatgtgtcgcgctttgccgctttgggcataccggcggtcaat
tacggcccaggtgatcccaacctggcgcactgccgcgacgaacgggtgcccgtcggcaac
atcaccgcggccgtggacttgctgcgccgatacctgggtggctag

DBGET integrated database retrieval system