KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1582Help
Entry
BCG_1582          CDS       T00463                                 

Gene name
adh
Definition
alcohol dehydrogenase adh (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCG_1582 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_1582 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_1582 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCG_1582 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCG_1582 (adh)
   00626 Naphthalene degradation
    BCG_1582 (adh)
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCG_1582 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1743714..1744817
Genome map
AA seq 367 aa AA seqDB search
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAF
VPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMY
GFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKP
GDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDP
VAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVV
FKELRVLGALGVDATAYRAALDLLVSGRYLFASLPRRCVRLEGAEDLLATMAGERDGVPP
IHGVLTP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcgcggtggtacgggcattggtattggaggcgccgcgcaggctggtcgtg
cgccagtaccggctgccgcgcatcggcgatgatgacgcactagtgcgagtagaggcctgc
gggctgtgcggcaccgatcacgagcaatacacgggcgagctggccggtgggtttgccttc
gtacctggccacgagacggtcgggacgattgcggccatcggtccgcgggcggagcagcgg
tggggcgtgtcggccggcgaccgagtagccgtcgaggtattccagtcgtgtcggcagtgc
gctaactgtcgtggcggcgagtaccggcgttgtgtacggcatggcctcgctgacatgtac
gggttcatcccggttgaccgagagcctggcctgtggggcggttacgccgaatatcagtac
ctggcgccggattcgatggtgttgcgggtggccggtgacctcagcccggaagtggccacc
ttgttcaacccgctgggggcgggaatacgttggggagtaacgattcccgaaaccaaaccg
ggcgacgtcgtggcggtgctgggtccaggaatccgggggctgtgcgccgccgcggcggca
aaaggggccggtgccgggttcgtgatggtgaccgggttgggaccccgtgacgccgaccgg
ttggcgctggcggcacagttcggagccgacctcgccgtcgatgttgcgatcgatgacccg
gtcgccgccctgaccgaacagaccggtgggctggcagacgtcgttgtcgacgtgaccgcc
aaggcgccagcggcattcgcacaggcgatagcgctagcccggcccgccgggaccgttgtt
gtcgccggcacccggggcgtgggcagcggggcaccgggattttcgcccgacgtcgttgtg
ttcaaggagctgcgtgtgcttggcgccctcggcgtagacgccaccgcctaccgggccgcg
cttgatctgttggtgtccggtcgatacctcttcgcaagcctgcctcgccgctgcgtgcgg
ctcgaaggcgccgaggatctgctggctaccatggccggtgaacgcgacggtgtcccgcct
atccacggagtgctcacaccatga

DBGET integrated database retrieval system