KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1582Help
Entry
BCG_1582          CDS       T00463                                 

Gene name
adh
Definition
(GenBank) Probable alcohol dehydrogenase adh
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00010  Glycolysis / Gluconeogenesis
mbb00071  Fatty acid degradation
mbb00350  Tyrosine metabolism
mbb00625  Chloroalkane and chloroalkene degradation
mbb00626  Naphthalene degradation
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_1582 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_1582 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCG_1582 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCG_1582 (adh)
   00626 Naphthalene degradation
    BCG_1582 (adh)
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCG_1582 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C DapB_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAL71569
UniProt: A0A0H3M445
Position
1743714..1744817
Genome map
AA seq 367 aa AA seqDB search
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAF
VPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMY
GFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKP
GDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDP
VAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVV
FKELRVLGALGVDATAYRAALDLLVSGRYLFASLPRRCVRLEGAEDLLATMAGERDGVPP
IHGVLTP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcgcggtggtacgggcattggtattggaggcgccgcgcaggctggtcgtg
cgccagtaccggctgccgcgcatcggcgatgatgacgcactagtgcgagtagaggcctgc
gggctgtgcggcaccgatcacgagcaatacacgggcgagctggccggtgggtttgccttc
gtacctggccacgagacggtcgggacgattgcggccatcggtccgcgggcggagcagcgg
tggggcgtgtcggccggcgaccgagtagccgtcgaggtattccagtcgtgtcggcagtgc
gctaactgtcgtggcggcgagtaccggcgttgtgtacggcatggcctcgctgacatgtac
gggttcatcccggttgaccgagagcctggcctgtggggcggttacgccgaatatcagtac
ctggcgccggattcgatggtgttgcgggtggccggtgacctcagcccggaagtggccacc
ttgttcaacccgctgggggcgggaatacgttggggagtaacgattcccgaaaccaaaccg
ggcgacgtcgtggcggtgctgggtccaggaatccgggggctgtgcgccgccgcggcggca
aaaggggccggtgccgggttcgtgatggtgaccgggttgggaccccgtgacgccgaccgg
ttggcgctggcggcacagttcggagccgacctcgccgtcgatgttgcgatcgatgacccg
gtcgccgccctgaccgaacagaccggtgggctggcagacgtcgttgtcgacgtgaccgcc
aaggcgccagcggcattcgcacaggcgatagcgctagcccggcccgccgggaccgttgtt
gtcgccggcacccggggcgtgggcagcggggcaccgggattttcgcccgacgtcgttgtg
ttcaaggagctgcgtgtgcttggcgccctcggcgtagacgccaccgcctaccgggccgcg
cttgatctgttggtgtccggtcgatacctcttcgcaagcctgcctcgccgctgcgtgcgg
ctcgaaggcgccgaggatctgctggctaccatggccggtgaacgcgacggtgtcccgcct
atccacggagtgctcacaccatga

DBGET integrated database retrieval system