KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1649Help
Entry
BCG_1649          CDS       T00463                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCG_1649 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG_1649 (trpC)
Enzymes [BR:mbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCG_1649 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1815487..1816305
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR
ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgctcgactccatcctcgagggagtccgggccgacgttgccgcg
cgtgaagcctcggtgagcctgtcggagatcaaggctgccgccgctgcggcgccgccgccg
ctcgacgtgatggccgccctacgcgagcccggcatcggcgtcatcgctgaggtcaagcgc
gctagtccttcggcaggcgcattggcgaccatcgccgacccggcaaagctggcccaggcc
taccaggatggcggtgcccggatcgtcagcgtggtgactgagcagcggcgttttcaggga
tcgctcgacgacctcgacgcggtgcgggcctcggtttcgattccggtgctgcgcaaggac
tttgtggtgcagccgtaccagattcatgaggcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcattggagcagtcggtgttggtgtcgatgttggaccgcaccgaatcg
ttgggtatgacagcactcgtcgaggtccataccgagcaggaagccgaccgagcgctgaag
gccggggccaaggtgattggcgttaacgcccgcgacctcatgacgctggacgtggaccgg
gattgcttcgcgcgaatagctcctggtttgccgagcagtgtgatcaggattgctgaatcc
ggcgtgcgtggcaccgctgacctgctggcgtacgccggcgcgggcgctgacgcggtgttg
gtaggcgaaggtctggtcaccagcggcgacccacgtgccgcggttgccgatctggttacc
gcgggcacccatccgtcctgtccgaaaccggctcgctag

DBGET integrated database retrieval system