KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1650Help
Entry
BCG_1650          CDS       T00463                                 

Gene name
trpB
Definition
(GenBank) Probable tryptophan synthase, beta subunit trpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00260  Glycine, serine and threonine metabolism
mbb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01130  Biosynthesis of antibiotics
mbb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG_1650 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG_1650 (trpB)
Enzymes [BR:mbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCG_1650 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: CAL71637
UniProt: A0A0H3MAK1
Position
1816374..1817606
Genome map
AA seq 410 aa AA seqDB search
MSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERVSQDFLDDLDR
LQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV
IAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTL
KDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDA
VVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAFGLLCRMEGII
PAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLGND
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgccatcgccgaaccgaccagtcacgatcctgattccggcggccatttcggc
ggccccagtggttggggtggccgctacgttcccgaggcgctgatggcggtgatcgaagag
gtcaccgccgcctaccaaaaggagcgcgtcagccaggactttctggacgacctagacagg
ctgcaggcgaactatgcgggccggccttcgccgctttacgaggcgacccggttgagccag
cacgctgggtcggcgcgaatctttctgaagcgagaagacctgaaccatactggttctcac
aagatcaacaacgtgctcgggcaggcactgctggcgcgcaggatgggcaagacccgggtg
atcgccgagaccggtgccggccagcacggggtcgccacggccaccgcatgcgcattgctc
ggcctggactgtgtcatctacatggggggcatcgacaccgcccgtcaggcgctaaacgtg
gcccggatgcgattgctgggtgccgaagtcgtcgcggttcagacgggctcgaaaacgctc
aaagacgccatcaatgaggcgttccgggattgggttgccaacgccgacaacacctactac
tgctttggtactgcggccggaccgcatccgtttccaaccatggtgcgcgatttccagcga
atcatcggcatggaggcacgtgtgcagatccagggtcaggccggtcggctgcctgacgcc
gtcgtcgcgtgcgttggtggcgggtccaatgccattggtatttttcatgcgtttctcgat
gacccaggcgtacggctggtcggattcgaggcagccggcgacggcgttgagaccggccgg
catgccgcgacattcaccgctggttcgcccggggcatttcacggatcgttctcgtacttg
ctgcaagacgaggacggtcagaccattgaatcccattcaatttccgcgggtctggattat
ccgggggtgggcccggaacatgcgtggctcaaggaggccgggcgtgtcgattatcggccg
atcaccgactccgaggcgatggacgcgtttggcctgctgtgtcgcatggaaggcatcatc
ccggctattgaatccgcgcacgcggtggccggcgccctcaagctaggtgttgagttggga
aggggcgcggtgattgtggtgaacctgtcgggacgtggcgacaaagatgtcgagacggcc
gcgaaatggtttggcttgctgggcaacgactga

DBGET integrated database retrieval system