KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1741cHelp
Entry
BCG_1741c         CDS       T00463                                 

Definition
catechol-o-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCG_1741c
Enzymes [BR:mbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     BCG_1741c
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BCG_1741c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1934348..1934938)
Genome map
AA seq 196 aa AA seqDB search
MLATIDKFAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYSALRIARAAPEAR
VYSVELAEANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLD
HDKKAYLPDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLE
YQTLVPDLVLESEYLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgac
gagaaagggacgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggag
ttgggcacctacctcggctacagcgcgctgcggatcgcccgggccgctccggaggccagg
gtgtactccgtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcat
gccggcgtcgatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcacc
ctggacgcgctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgac
catgacaagaaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcac
ccgggctcgatcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgca
tatatgcgccggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaa
taccagaccctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system