KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1944cHelp
Entry
BCG_1944c         CDS       T00463                                 

Gene name
aao
Definition
D-amino acid oxidase aao (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mbb00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mbb00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mbb00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:mbb00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2152463..2153425)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDT
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacacc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system