KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1954Help
Entry
BCG_1954          CDS       T00463                                 

Gene name
aceA
Definition
isocitrate lyase aceA (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mbb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mbb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2161493..2163793
Genome map
AA seq 766 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADADT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGV
KELNGHLLYALGDSEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGIFDQVESRFVA
AWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPP
WDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFP
DQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATAL
RQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQ
PIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSK
MKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagtcgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgcagcccgcaagagc
atcacgacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacctcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccaacactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccgacacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgcggaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgtttttacgaactgggcgtc
aaggagctcaatggtcatcttctctatgcgcttggcgacagcgagtacgcggcggccggc
ggttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcgg
gaggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcg
gcctgggaggacgacgcgggcctgatgacctacggagaggccgtggcggacgtgctcgaa
ttcggtcagagcgagggcgaacccattggcatggctcccgaggagtggcgggcgttcgcc
gcgcgtgcatcgctgcatgccgcccgggcaaaggccaaggagctgggcgccgatccgcca
tgggactgcgagctggccaagaccccggagggctactaccagatccgcggcggcataccg
tatgcgatcgccaaatcgctggccgcggcaccgtttgccgacattctttggatggagacc
aagaccgccgatctcgccgacgctcgacagttcgccgaggcgatccatgccgagttcccc
gaccagatgctggcgtacaacctctcaccatcgttcaactgggacaccaccggcatgacc
gacgaggagatgcggcgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttc
atcacctatggcgggcaccagatcgacggtgtcgcggccgaggaattcgccaccgcgctg
cgccaggacggcatgctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatct
ccctatcgcacaccgcaaacgctagtcggcgggccgcgcagtgacgccgcattggctgcc
tcctccggacgcacggcgaccacgaaggcaatgggcaagggctccacccagcaccagcac
ttggtgcaaactgaggtgccgcgcaagctgctagaggaatggctggccatgtggagcggt
cactaccagctcaaagacaaactgcgcgtacagcttcggccgcagcgggccggctcggag
gtgctcgagctcggcatccacggcgaaagcgatgacaagctcgccaacgtgatattccaa
ccgatccaagatcgccgcggccgcaccatcctgttggtacgcgaccagaacacgttcggt
gcggaactacgccaaaagcggctgatgaccctgatccacctctggctcgtccaccgcttc
aaggcgcaggcggtgcactacgtcacgcccaccgacgacaacctctaccagacctcgaag
atgaagtcgcatggaatcttcaccgaggtcaaccaggaggtgggcgagatcatcgtcgcc
gaggtgaaccacccgcgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaag
ttgatcacgaaggaggcgtag

DBGET integrated database retrieval system