KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1974cHelp
Entry
BCG_1974c         CDS       T00463                                 

Gene name
echA13
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCG_1974c (echA13)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCG_1974c (echA13)
   00650 Butanoate metabolism
    BCG_1974c (echA13)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_1974c (echA13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_1974c (echA13)
   00310 Lysine degradation
    BCG_1974c (echA13)
   00360 Phenylalanine metabolism
    BCG_1974c (echA13)
   00380 Tryptophan metabolism
    BCG_1974c (echA13)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCG_1974c (echA13)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCG_1974c (echA13)
   00281 Geraniol degradation
    BCG_1974c (echA13)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_1974c (echA13)
   00627 Aminobenzoate degradation
    BCG_1974c (echA13)
   00930 Caprolactam degradation
    BCG_1974c (echA13)
Enzymes [BR:mbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCG_1974c (echA13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2188363..2189319)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system