KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2062cHelp
Entry
BCG_2062c         CDS       T00463                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidas pncA (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mbb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2272333..2272893)
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDDFSG
TPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttgatcatcgtcgacgtgcagaacgacttctgcgagggtggctcgctggcg
gtaaccggtggcgccgcgctggcccgcgccatcagcgactacctggccgaagcggcggac
taccatcacgtcgtggcaaccaaggacttccacatcgacccgggtgacgacttctccggc
acaccggactattcctcgtcgtggccaccgcattgcgtcagcggtactcccggcgcggac
ttccatcccagtctggacacgtcggcaatcgaggcggtgttctacaagggtgcctacacc
ggagcgtacagcggcttcgaaggagtcgacgagaacggcacgccactgctgaattggctg
cggcaacgcggcgtcgatgaggtcgatgtggtcggtattgccaccgatcattgtgtgcgc
cagacggccgaggacgcggtacgcaatggcttggccaccagggtgctggtggacctgaca
gcgggtgtgtcggccgataccaccgtcgccgcgctggaggagatgcgcaccgccagcgtc
gagttggtttgcagctcctga

DBGET integrated database retrieval system