KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2148cHelp
Entry
BCG_2148c         CDS       T00463                                 

Gene name
cysQ
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mbb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2372527..2373330)
Genome map
AA seq 267 aa AA seqDB search
MVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRR
LQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNG
QPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQ
PVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQL
DPYLPDLLMCRAEVAPILLGAIADAWR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagccctgccgcacctgatctgacggacgacctgactgacgccgagctggccgcc
gacctggcggcggacgcgggaaagctgttgctccaggtgcgtgcggagatcggtttcgat
cagccatggacgctcggggaagccggtgaccgccaggctaactcgctgctgttgcgacgg
ctgcaggccgaacggccgggtgacgcagtgctcagtgaggaggcccacgacgatctggcc
cggctgaaatccgatcgggtgtggattattgacccgttggatggcacccgcgagttctcc
acaccgggtcgcgacgactgggcggtacacattgcgctgtggcggcgttcctccaatggc
cagcccgagatcaccgacgccgcggtggcgttgccggcccgtggcaacgtggtgtaccgc
accgatacggtgacttccggcgccgcgccggccggcgttcctggcaccttgcggattgcc
gtcagcgccacccggccaccggcagtcctgcaccgcatccgccagacgctggcgatccaa
ccggtgtcgatcggttcggcgggcgccaaagcgatggccgtcattgacggctacgtcgac
gcctacctgcacgccggaggccaatgggagtgggattccgcggcgccggctggggtgatg
ttggccgccggcatgcacgcgtcacgactcgatggctcgccgctgcgatacaaccaactg
gacccctacctgccggatctgctgatgtgtcgagccgaggtggcgccgatcctgctcggt
gccatcgccgacgcgtggcgctga

DBGET integrated database retrieval system