KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2175cHelp
Entry
BCG_2175c         CDS       T00463                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCG_2175c (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCG_2175c (murE)
Enzymes [BR:mbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BCG_2175c (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2399011..2400618)
Genome map
AA seq 535 aa AA seqDB search
MSSLARGISRRRTEVATQVEAAPTGLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDR
TVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVP
VLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGT
IGIRVGGADLPSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGA
FTNLSRDHLDFHPSMADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVS
AADRPAHWRATDVAPTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGV
SPEQAVPGLREIRVPGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGA
GGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIAD
RRDAIRHAVAWARPGDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgctggcccgagggatctcgcggcggcgaacggaggtggcgacacaggtggag
gctgcgcccactggcttgcgccccaacgccgtcgtgggcgttcggttggccgcactggcc
gatcaggtcggcgcggccctggccgagggtccagctcagcgtgccgtcaccgaggaccgg
acggtcaccggggtcacgctgcgcgcccaggacgtgtcacccggtgacctgttcgccgcc
ctgaccggctcgaccacccacggggcccgccacgtcggcgacgcgatcgcacgcggcgcc
gtcgcggtgctcaccgaccccgccggggtcgccgagatcgccggacgagcggccgtgccc
gtgttggtgcaccccgcaccccgcggcgtgctcggcggcttggccgccaccgtgtacggg
catccgtccgagcggttgacggttatcgggatcaccggaacgtccggcaagaccaccacc
acctatctggtcgaggccgggttacgggctgccggacgcgtcgccgggctgatcggcacc
atcggcatccgcgtcggcggcgccgaccttcccagcgcgctgaccaccccggaggccccc
acgctgcaggcgatgctggcggcgatggtcgaacgcggggtggacaccgtggtcatggag
gtgtccagccacgcgctggcgctgggccgggtggacggcacccggttcgccgtcggcgcc
ttcaccaatctctcccgtgaccacctggatttccaccccagcatggccgactacttcgag
gccaaggcgtcattgttcgatccggactcggcactgcgcgcccgcaccgccgtggtgtgc
atcgacgacgacgccgggcgcgcgatggcggcgcgggccgccgacgcgatcaccgtcagc
gccgccgaccggcccgcacactggcgcgccacggatgtggcgcccacggacgcgggcggg
caacaattcaccgccatcgaccccgccggcgtagggcatcacatcggaatccggctaccg
ggccgctacaacgtcgccaattgcctggtcgccctggcgattctggacaccgtcggggtc
tccccggaacaggcggtgccgggcctgcgtgagatccgggtcccggggcggctcgagcag
atcgaccgcggccagggctttctcgcgctggtcgactacgcgcacaaaccggaagcgctg
cggtcggtgctgaccaccttggcgcacccggaccgccggctggcggtggtgttcggcgcc
ggcggcgatcgtgacccgggcaagcgggccccgatgggccggatagccgcgcagctggcc
gacttggtggtcgtcaccgacgacaacccgcgtgacgaagatcccacggcgatccgccgc
gaaatcctggctggggcggccgaagtcggcggtgatgcccaggtcgtcgagatcgcagac
cggcgggacgcgatccggcacgcggtcgcctgggcgcgccccggcgacgtggtgctcatc
gccggcaaaggccacgagaccgggcaacgcggcggcgggcgggtccgcccgttcgacgac
cgggtggagctggctgccgcgctagaggccctcgagcggcgcgcatga

DBGET integrated database retrieval system