KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2231Help
Entry
BCG_2231          CDS       T00463                                 

Gene name
dlaT
Definition
(GenBank) DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00020  Citrate cycle (TCA cycle)
mbb00310  Lysine degradation
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
Module
mbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCG_2231 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    BCG_2231 (dlaT)
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCG_2231 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: CAL72219
UniProt: A0A0H3M5S4
Position
2460609..2462270
Genome map
AA seq 553 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVIRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAGAAEG
APYVTPLVRKLASENNIDLAGVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAAAAPA
PKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGLRARA
KAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVDTEQG
LLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPIL
VPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYVPLTYDHRLIDGADAGRFLTTIKH
RLEEGAFEADLGL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcattcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccaagcccgtccccgagccagcgccgacg
ccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggtgcggccgagggc
gcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaacatcgacctcgcc
ggggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtgctggccgcggct
gagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgccgccgcgccggcc
ccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggcaccacccagaag
gccagccggattcgtcagatcaccgccaacaagacccgcgaatctttgcaggcaacggca
cagctgacacaaacccatgaggtcgacatgaccaagatcgtggggctacgggcccgggcc
aaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccgttcttcgccaag
gccgtgatcgatgccctcaagattcacccgaacatcaacgctagctacaacgaggacacc
aaggagatcacctactacgacgccgagcacctaggattcgctgtcgacaccgagcagggc
ctgctctccccggtcatccacgacgccggcgatctgtcactggccggtctggcgcgggcg
atcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgacgagttgtccggc
ggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgacaccccgatcctg
gttccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccgcgggtggtc
gtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctacgtcccgttgacc
tatgaccatcggctcatcgacggcgccgacgccggacgtttcctcaccacgatcaagcac
cgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system