KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2870cHelp
Entry
BCG_2870c         CDS       T00463                                 

Definition
magnesium chelatase (EC:4.99.1.-)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mbb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3112151..3114040)
Genome map
AA seq 629 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE
TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV
RVQVIRRRMAYEADPDAFVARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF
DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIQAAAELALPHRRRRDPFDDHGIDRDQLD
EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSS
PRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLL
AAGERAFGAGPLRPWPDDVRRAIRESREGNLVIFVVDASGSMAARDRMAAVSGATLSLLR
DAYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIR
EKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA
QLARQLGAPVVRLEQLHADYLVHAVRGVA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccttatccgttcagcgcgatcgtcgggcacgatcggctgcggctcgcgttgttg
ttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacggcg
aaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcaccgag
accggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctggat
ctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgcgcc
cacggcggcgtgctctacgtcgacgaggtcaatctgctgcatgatcacctggttgacatc
ctgctcgacgccgccgccatgggacgcgtacacgtcgaacgcgacggcatctcccattcc
cacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgtccg
cagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgacgtg
cgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgtcgca
cgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgggccacggta
gacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcgttc
gacgtggacggcatgcgggccgatctggtagtggcccggaccgccgccgcgcacgccgcc
tggcgtggtgtccgcaccgttgaggagcaggatatccaggcggcagcagaactggcgttg
ccgcatcgtcgtcgtcgcgacccgttcgacgatcacggcatcgaccgcgaccagctggat
gaggcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggcggc
cagtcagccaatgaacctgcctcacaaccgaactcacgctcgaagtcgacagaacctggt
gcgccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcgtcg
ccgcgcccgagcgcgccgccgtcaaagatattccggacccgcgcgctgcgggtcccgggg
gtcggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtggtg
gcggccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgctaccctgctg
gccgccggcgagcgtgcgttcggagccgggccgttgcgcccgtggccggacgatgtgcgc
cgggccatccgcgagagtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttccgga
tcgatggctgctcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctgcgc
gacgcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggcaacg
ctgttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattcagc
accggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatccgg
gagaaggtacgcgaccgcgcccgacgccccctggtggtcgtgctgaccgacggccgggcc
accgccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgccgag
ggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggcagcg
caactggctcgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggattat
ctagtgcatgccgtgcgtggcgtggcttga

DBGET integrated database retrieval system