KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2892cHelp
Entry
BCG_2892c         CDS       T00463                                 

Gene name
dxr
Definition
(GenBank) Probable 1-deoxy-d-xylulose 5-phosphate reductoisomerase dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00900  Terpenoid backbone biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01130  Biosynthesis of antibiotics
Module
mbb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_2892c (dxr)
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCG_2892c (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP Semialdhyde_dh CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: CAL72881
UniProt: A1KML5
Position
complement(3135702..3136943)
Genome map
AA seq 413 aa AA seqDB search
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactcgaccgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagt
accggctcgatcggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgag
gtagtcgggctggccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcag
accggggtgaccaatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatc
ccctaccacggatccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtc
ctcaatgcgctggtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggt
gcccggctggcgctggccaacaaggaatcgctggtcgccggtggttcgctggtgctgcgg
gcggcgcggcccggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgc
ctgcgcggcggcactcccgacgaggtcgccaagctggtgctgacggcctcgggagggccg
tttcggggctggtccgcggccgacctcgagcatgtcacccccgagcaggctggcgcgcat
cctacgtggtcgatgggcccgatgaacacgctgaattcggcgtcgctggtcaacaaggga
cttgaggtcatcgaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtg
gtgcacccccagtcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcc
caggccagtcccccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgg
gtcagcggcgccgctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccg
ttggacaccgacgtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggc
tgcatgaccgcggtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggc
cggatcggcttcccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaa
tgggccgtcgaacccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgag
cgagcgcagcgcgcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccg
ggcgcagcgggtcgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system