KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3380cHelp
Entry
BCG_3380c         CDS       T00463                                 

Gene name
deoA
Definition
(GenBank) Probable thymidine phosphorylase deoA
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00240  Pyrimidine metabolism
mbb00983  Drug metabolism - other enzymes
mbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCG_3380c (deoA)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    BCG_3380c (deoA)
Enzymes [BR:mbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BCG_3380c (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CAL73369
UniProt: A0A0H3M8P2
Position
complement(3690755..3692038)
Genome map
AA seq 427 aa AA seqDB search
MTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRWLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgcattcgacgccccgaccgtcatccgcaccaaacgtgacggcggccgg
ttgtccgacgccgccatcgactgggtcgtcaaggcctataccgacggccgggtcgccgac
gaacagatgtcggcgctgctgatggcgatcgtttggcggggcatggaccgcggcgagatc
gccagatggacggcggccatgctggcctcgggtgcccggctggatttcaccgatctgcca
ctagcgaccgtggacaagcattccaccggcggggtaggtgacaaaatcacgctgccattg
gtgcccgtcgtcgccgcctgcggtggcgcagtgccccaggcgtcgggccgcggactcggc
cacaccggcggcaccctggacaagctggaatccatcaccgggttcaccgcgaatctgtcc
aaccagcgggtgcgcgagcagctttgcgacgtcggcgccgcgatcttcgccgccggccag
ctggcgccagccgatgccaagctgtatgcgctgcgcgacattaccggcaccgtcgaatcg
ctgccgttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactg
gtgctcgacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaa
cttgcgcacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgtgccctgctg
acggagatgaactgcccgctgggtcgaaccgtcggcaatgcgctcgaggtggccgaggcg
ctggaggtgctggccggcggcggaccgcccgacgtggtggagctgacgttgcggctggcc
ggcgagatgctcgagcttgccgggatccacggccgggacccggcccagacgctgcgggac
ggcaccgcaatggaccggtttcgctggttggttgccgcgcagggaggtgacttgtcgaaa
ccgttgccgatcggttcgcattcggaaaccgtcacggcgggcgcgagcggcacaatgggc
gacatcgatgcgatggcagtggggttagcggcatggcgactcggtgcgggcaggtcccgc
ccgggcgcacgcgtacagcacggtgcgggggtgcggattcatcgccgcccgggggagccg
gttgtggtcggtgagccgttgttcaccctctacacgaatgctcccgagcgctttggtgcg
gcgcgagccgagctggccggcggttggagtatccgggacagtccgccgcaggtgcggccg
ctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system