KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3599cHelp
Entry
BCG_3599c         CDS       T00463                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCG_3599c
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG_3599c
   00650 Butanoate metabolism
    BCG_3599c
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCG_3599c
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_3599c
   00622 Xylene degradation
    BCG_3599c
   00621 Dioxin degradation
    BCG_3599c
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCG_3599c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3952481..3953392)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcggggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system