KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3670cHelp
Entry
BCG_3670c         CDS       T00463                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCG_3670c (folK)
Enzymes [BR:mbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BCG_3670c (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4027095..4027661)
Genome map
AA seq 188 aa AA seqDB search
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAEEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggtagtgctctcggttggctccaacctgggtgaccgcctggcacgattgcgg
tcggtcgccgacggtctcggcgatgcgttgattgcggcttccccgatatatgaggccgac
ccctggggtggggtggagcaggggcagttcctcaatgcggtgctgatcgccgacgatcct
acctgcgaaccgcgggagtggctgcggcgggcggaggagttcgagcgcgctgcgggcagg
gtgcgtggccagcgctggggtccacgaaatctcgacgtcgacctgatcgcctgctaccag
acctcggccaccgaggctctggtcgaagtgaccgcgcgggagaaccacctcacgctgccg
cacccactggcgcatctgcgggcctttgtgttgatcccgtggattgccgtcgacccaacg
gcgcagctgacggttgccgggtgcccgcggcccgtcacgcgactgctggccgagctggag
cccgccgaccgcgacagtgtgcggttgtttaggccgtcgttcgatctgaatagcagacac
cccgtcagtcgggcaccggaaagctga

DBGET integrated database retrieval system