KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3725Help
Entry
BCG_3725          CDS       T00463                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00010  Glycolysis / Gluconeogenesis
mbb00620  Pyruvate metabolism
mbb00640  Propanoate metabolism
mbb00680  Methane metabolism
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_3725 (acs)
   00620 Pyruvate metabolism
    BCG_3725 (acs)
   00640 Propanoate metabolism
    BCG_3725 (acs)
  Energy metabolism
   00680 Methane metabolism
    BCG_3725 (acs)
Enzymes [BR:mbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCG_3725 (acs)
Lipid biosynthesis proteins [BR:mbb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCG_3725 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAL73714
UniProt: A0A0H3M9N8
Position
4080905..4082860
Genome map
AA seq 651 aa AA seqDB search
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWS
GAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAK
LLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVV
GSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDV
FWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTL
IRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGS
AMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSML
RGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEV
ESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIAR
PRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcacttcgccgag
cacgcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgg
gccaagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcg
ggggcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtg
gatcgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccg
gtcggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcg
aacgcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttg
atccctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgtt
gttttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaag
ctgctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggcc
gctgacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcgg
cgcacgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtc
ggctcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctg
ctgtacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctat
ctcactcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtg
ttctggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccg
ctgtgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacac
cggcatttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctc
atccggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctg
cggctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgat
gtcatcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctcc
gcgatgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccg
ctgcccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacacc
gagggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttg
cgcggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgac
aagggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggta
ctaggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtg
gaatcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgac
gagaccacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccat
gaccgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacgg
ccacgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgt
cgactgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgat
cccaccgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system