KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3836Help
Entry
BCG_3836          CDS       T00463                                 

Gene name
echA21
Definition
(GenBank) Putative enoyl-CoA hydratase echA21
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00071  Fatty acid degradation
mbb00280  Valine, leucine and isoleucine degradation
mbb00281  Geraniol degradation
mbb00310  Lysine degradation
mbb00360  Phenylalanine metabolism
mbb00362  Benzoate degradation
mbb00380  Tryptophan metabolism
mbb00410  beta-Alanine metabolism
mbb00627  Aminobenzoate degradation
mbb00640  Propanoate metabolism
mbb00650  Butanoate metabolism
mbb00903  Limonene and pinene degradation
mbb00930  Caprolactam degradation
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01212  Fatty acid metabolism
Module
mbb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCG_3836 (echA21)
   00650 Butanoate metabolism
    BCG_3836 (echA21)
  Lipid metabolism
   00071 Fatty acid degradation
    BCG_3836 (echA21)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_3836 (echA21)
   00310 Lysine degradation
    BCG_3836 (echA21)
   00360 Phenylalanine metabolism
    BCG_3836 (echA21)
   00380 Tryptophan metabolism
    BCG_3836 (echA21)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCG_3836 (echA21)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCG_3836 (echA21)
   00281 Geraniol degradation
    BCG_3836 (echA21)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_3836 (echA21)
   00627 Aminobenzoate degradation
    BCG_3836 (echA21)
   00930 Caprolactam degradation
    BCG_3836 (echA21)
Enzymes [BR:mbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCG_3836 (echA21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAL73826
UniProt: A0A0H3MBZ3
Position
4191252..4192076
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaacgcgatggggcccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaat
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

DBGET integrated database retrieval system