KEGG   Marssonina brunnea: MBM_01163Help
Entry
MBM_01163         CDS       T03105                                 

Definition
alpha amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mbe  Marssonina brunnea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MBM_01163
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MBM_01163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 511 aa AA seqDB search
MGDYEQKPTPENMTMMQAFEWYVPDDHKHWIRLHDNVLQMKAVGIDNIWVPPGCKASSPS
GNGYDIYDLYDLGEFDQKGGKATKWGTKEELVAMVKKANEVGVGIYWDAVLNHKAAADHK
EKCQVQEVDSNDRNKTISDPYQIDAWLGFDFPGRGEKYSAQKYHWFHFSGTDYNASNSKT
AIYKILGDKTKGWAVDGDVDSENGNYDYLMFADLDYSHPEVEKDVLDWGTWLSKEIKIKG
MRFDAVKHFSEDFLRKFITLMDEMYGEGWFFVGEFWKDSLSDMSAYLQRMGKKFSLFDAP
LVYNFSKLSKTEGGDLRKVFDDTLVQVEPINAVTLVMNHDTQPYQALEAAIEPFFKPLAY
ALILLRDRGYPCVFYGDLYGIKGEHPFPPSCGGALPSLILARKLYAYGKQADYFDFATCI
GWVRYGTWDKRFGCATVMSNAGPGEKRMHVGEMHAGEKWTDVLGWGEGEVEIDSEGYGMF
TCPGVSLAVWVNKEAEGRDQFGKFDSDIYKT
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggggactatgagcagaagcccacgccggagaacatgaccatgatgcaagcattcgaa
tggtacgtgccagacgatcataagcactggatccggctccacgacaacgtcctgcagatg
aaagccgttgggatcgacaacatatgggtccccccaggatgcaaagcctcttccccttct
ggtaatggctacgatatctatgatctatacgacctcggtgaattcgatcaaaagggaggc
aaggcaacgaaatggggtaccaaggaagagctcgtggcgatggtgaagaaggccaacgag
gttggtgtagggatctactgggatgcagtgctcaaccataaagctgctgccgaccacaag
gagaagtgccaagtccaagaagtcgattccaacgaccgcaacaaaaccatctcggacccg
tatcagatcgatgcatggctaggctttgacttccctggtcgaggtgagaaatactctgcg
cagaagtaccactggttccatttctcaggaacagactacaatgccagcaatagcaagact
gccatctacaagattctcggagacaagacgaagggctgggcggtcgacggcgatgtcgat
tccgagaatggcaactacgactacctcatgttcgccgatcttgattactctcacccagaa
gttgaaaaagacgtcctcgattggggtacttggttgagcaaggagattaagatcaagggc
atgcgtttcgacgcggtgaagcattttagtgaagactttctgcgcaagttcattacgcta
atggacgagatgtacggtgaggggtggttcttcgtcggagagttttggaaagacagtttg
tcggacatgagtgcgtacttgcagcgcatgggtaagaagttcagcttgtttgacgcgcca
ttggtgtataattttagcaagttgagcaagactgagggaggggacttgagaaaggtcttt
gatgatacgctagtgcaggtcgagcctatcaatgctgtgactttggtcatgaaccacgac
actcaaccctatcaagcccttgaggctgccatcgagcccttcttcaaaccgctagcttac
gctttgattctcttgcgtgatcgcggctacccctgcgtcttctatggtgatctctacggt
attaaaggcgagcacccattcccaccttcctgcggaggtgctcttccatccctgatattg
gcccgtaaactttatgcctatggtaaacaagccgattatttcgactttgctacctgcatt
ggctgggttcgctacggtacctgggacaagcgattcggatgtgccacagtcatgagcaat
gccggacctggtgagaagagaatgcacgtgggtgagatgcatgcgggggagaagtggacg
gatgttcttggatggggagaaggggaagtggagattgattccgagggatatgggatgttt
acttgccctggtgtaagcctggctgtctgggtgaataaggaagcggagggcagagatcag
ttcgggaagtttgacagtgatatctacaaaacatag

DBGET integrated database retrieval system