KEGG   Marssonina brunnea: MBM_01941Help
Entry
MBM_01941         CDS       T03105                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mbe  Marssonina brunnea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MBM_01941
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MBM_01941
Exosome [BR:mbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MBM_01941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 800 aa AA seqDB search
MAPAEPLFAGNRRDSSLHSEERAADEDTALLGNTHKTSSSSRNRVRFWREVGLFTWALIA
TAAVIVLAVYTQHQSYIHDGKGQSQPSKPTGKRNLIFMVSDGMGPASLSMTRSFRQFRDG
VPIDDTLVLDQHFIGSSRTRSSSSLVTDSAAGATAFSCGLKSYNGAISMLPDYTPCGTVL
EAAKKAGYLTGLVVTTDITDATPACFASHVKMRMEQDLIAQQEVGEHPLGRVVDLMLGGG
RCHFLPNTSEGGCRADDRDITKLAQDEFGWSYIDSRGDFDDLDLGNNVKLPLLGLFADRD
IPFDLDRRNMNDVYPSLDEMARTALKALELATADSDKGFFLMIEGSRIDHAGHGNDPAAQ
VNEVLAYDVAFSSVIEFIERSENAGVLVATSDHETGGLSVARQINPAYPEYKWFPEVLAN
ASHSSEYLAGQLNSYIAEFGKTDKLEKYISENLVRKGLGITDLSKQELQSLIDNPLLSFY
IFADMISRRAQIGWSTHGHTAVDVNIYGTAGSEGLHGNHENTEIGEFLRNYLDLDVQAIT
DELVGKLDTFSIPDSGKSSMQNTLPSYDVGQRLQVFRRSHNDTSLTWHQTTALYSLRIPR
LARGNFSSTPRLIHTQRTMFVPPIHQFAESTISLSSTVTPSTLTPPMPLIRYLPSRISQL
TSHSTITSPPSRPSSPPPRNKLESCVKTMSFVRRSDGEDKAIRFVMLQRSSDSSPVGATH
VSHVRGLGTSYDQPFSASTGWEGASERIREEFEGGRNTCTCTFTCLCTYFLETVAPPPNS
LSRFTSGKAILADRRLIDLN
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgccgaacctttgtttgcgggcaatagaagagactcctctctacactccgaa
gagcgcgctgcagacgaagacacagctctactaggaaacacccacaagacttcatcctca
tcccggaatcgagttaggttctggcgcgaagttgggctgtttacatgggctttgatagct
acagctgctgttatcgttcttgcggtctacacacaacaccaatcttacattcatgatggc
aagggacagtcacaacccagcaaaccaactgggaagcgcaacttgattttcatggtgtca
gatggtatggggcctgcgagtctgtccatgaccaggtcgtttcggcagtttcgagatggc
gtccctatcgacgacactctcgttcttgatcaacattttatcggctcctctcgcacacgc
tctagtagcagtctagttactgattcggccgctggcgcaactgcattctcctgcggacta
aagagctacaatggggctatatctatgctacccgattatacgccctgcggtactgttttg
gaagctgcaaagaaggcgggctatctcaccggattggtcgtgacaacagatatcacagat
gctacacctgcttgtttcgcttcccatgtcaagatgagaatggagcaagatttgatcgcg
caacaggaagtaggggaacatccccttggacgggtcgtcgacctcatgcttggcggtggt
cgatgccatttcctcccaaatacttccgagggtggatgtagagctgacgacagagatatc
accaagctggcgcaggatgaattcgggtggagctacattgacagtcgtggagattttgac
gatctggacttggggaacaatgtcaagctccctctcctgggccttttcgccgacagagac
atcccattcgatcttgatcgacgaaacatgaacgatgtctatccctcgcttgacgaaatg
gcacgaacagcattgaaggcactcgaacttgcaaccgcagacagcgacaaggggttcttt
ttgatgatagagggaagtagaatcgatcacgcaggccacggaaacgatcccgctgcacag
gtcaacgaggttctcgcttatgatgtagctttttcatctgtcattgaatttatcgagagg
tcagagaatgccggtgtcttggttgcaacatctgaccacgagaccggtggcctctcagta
gccagacaaataaaccctgcgtaccccgaatataaatggtttcccgaagttctcgccaat
gcctcacactcatcagagtatctagctggacagctgaactcatacattgctgaatttggc
aagactgacaagctcgaaaagtatatcagtgaaaacctagtacgaaagggcctggggatc
acagacctcagcaagcaggagctgcaatctcttattgataatccgctgctcagcttttac
attttcgcggacatgatcagtcggcgtgcccaaatcggatggtcaactcatggccatacc
gcggtggatgttaacatatatggaacggccggctcagaaggtttgcacggcaatcacgag
aacaccgaaataggagaatttctccgaaactacctggaccttgatgttcaggccatcacc
gacgagctagttgggaagttggatactttcagcatcccagacagtggcaaatcatcaatg
cagaatactctgccttcctatgatgttggacaacgactgcaggtgttccggaggtcacac
aacgacacttcgttgacctggcatcaaaccactgcgctctattctctcaggatccctcgc
ttagccaggggtaacttcagttctactccaagactcattcacactcagcgcactatgttt
gtgccgcctatccaccagtttgcagaatctactatctctctctcctcgacagtcactccc
agcacgctcacacccccaatgccattgattcgctaccttccctcccgcatctcacagctc
acgagtcacagcacaatcacctctccgccatcacgcccttcgtctccaccccctcgcaac
aaattggaatcatgtgtgaaaaccatgtcgttcgttcggcgatcagatggggaagacaaa
gcgatcaggtttgtgatgctccaacgcagtagcgactcatccccggtgggtgcgacgcat
gttagccacgtccgaggcctggggacctcatatgaccagccgttctctgcttctactgga
tgggagggagcatctgagaggataagagaagagtttgaagggggccgtaatacttgtact
tgtacctttacttgcctttgcacttatttcctcgagactgtcgctccacctccgaattcg
ctatcacgcttcacgtctggaaaagcgatccttgcagacagacgtcttatcgatctcaac
tga

DBGET integrated database retrieval system