KEGG   Marssonina brunnea: MBM_03391Help
Entry
MBM_03391         CDS       T03105                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mbe  Marssonina brunnea
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MBM_03391
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MBM_03391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 346 aa AA seqDB search
MFARQAFRAAQPLKTQTRRYATEPSSGGSNTLLYAGVAALLAGGGYYFYNQGDNAAQVKD
AAKDAEAKAKGAVAAAKAKVDGATAKSAFTGGDQGFISLKLDSVENINHNTKKFRFALPE
EDQVSGLAVASALLTKYKGPEMEKPAIRPYTPVNDEGDLGFLDLLVKKYPGGVMSGHMHD
MVPGQRLDFKGPIPKYAWTPNKHSHVALIAGGTGITPMYQVARAIFNNPDDKTKVTLVFA
NVTEEDILLKKELAELENTYPQRFRAFYVLDKPAKGWTGGSGYITKELLKTVLPEPKEEN
IKIFVCGPPPMYKAISGVKKSPSDQGELDGSILEQLGYKKDQVYKF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaagacaagctttcagagcggctcagcccctgaagacgcaaactcgtcgatac
gccaccgaaccatccagcggaggatccaacacccttctgtatgctggtgtcgctgccctc
ttggcaggagggggatattatttctataatcaaggagacaatgcggcacaagtgaaggat
gcggcgaaagatgccgaagccaaggccaaaggcgctgtcgctgctgcaaaggcgaaggtg
gacggagcaactgcaaagtctgcgttcacgggaggagatcaaggcttcatcagcttgaag
ttggacagtgttgagaacatcaaccacaacaccaagaagttccgattcgccctgcccgag
gaagaccaagtaagcggactggccgttgcgtccgccctccttaccaaatacaagggcccg
gagatggagaagcccgccattagaccttataccccagtaaacgatgagggtgatctcgga
ttcctggatctcttggtgaagaaataccccggtggagtaatgtctgggcacatgcacgat
atggtcccgggacaaagactcgacttcaagggtccaatcccgaaatacgcatggacccca
aacaagcactctcacgtagcacttatcgccggaggaactgggattacacccatgtaccag
gttgcccgcgctatcttcaacaacccagacgacaagaccaaggtcacacttgtctttgcc
aatgttaccgaggaggacatcttgttgaagaaggagttggcagaactggagaacacctac
ccccagcgattccgagccttctatgttttggataagcccgcaaagggatggactggtgga
agtggatacatcaccaaggagctcttgaagactgttcttcctgagccaaaagaagagaac
atcaagatctttgtatgcggtccacctcctatgtacaaggctatctctggcgtcaagaag
tctccttcggaccagggcgagcttgatggcagcatcctcgagcaattgggttacaaaaag
gaccaagtctacaagttctag

DBGET integrated database retrieval system