KEGG   Marssonina brunnea: MBM_08920Help
Entry
MBM_08920         CDS       T03105                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mbe  Marssonina brunnea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MBM_08920
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MBM_08920
Exosome [BR:mbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MBM_08920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 500 aa AA seqDB search
MRVSVLTPLSVLASASYAQSTGPGDWQDALARNFIYIVPDGFGVASQTMARDYVSLLRNG
EDITRPVTSQLAADQMVLGSVRTQASDDLITDSAASATAFSAGIKTYNAAIGVDVAREPV
GSILEAAKLDGFKTGLVATSRITHATPACYAAHVEHRDLEAKIAEHQIGYSHPLGSVVDI
LLGGGRCYYVPKDSTGSCRDDDINLLEFAEEKGFNVFTDRAGFDSLQGGEEATLPYLGLF
ALNHMAYEVDRVDSLEPSLLEMTQTALTSLENATKNSTRGYFIMIEASRIDHAGHNNDPV
GHLHDTIQYNEVMEFVRRWVDARPDTQLMSAADHETGGLTLVGYNPLVLKAANSTSEFLN
GEFTAYNGSDPASFLRTNIFPAYGISDPTDAEILTLTQLKGEETFNNELGKMLSTRAGIQ
WSTDGHSAADVTLYGHSEGQGQMILRQNMAGNWDNTQLPLYLEKQLRLNLAAATEALRAN
GTDWVGREAVKRRSLGHHDH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttcggttcttaccccattgagcgttctcgcttccgcctcttacgctcagtca
acaggcccaggagactggcaggacgcactcgcaaggaacttcatctacatcgtcccagat
ggctttggtgttgcgtcccagactatggcgagggactatgtgtcgctgctgagaaacggg
gaggatatcacgcgacctgtgacttctcagctcgctgctgatcaaatggtcctcggctct
gtccgtacgcaagcaagtgacgacctgatcaccgactctgcagcaagtgctacagcgttc
tcggcgggtatcaagacttacaacgccgcgattggcgttgacgttgctagggagcctgtg
ggctctatcctcgaagctgcaaagctcgatgggttcaagacaggcttggttgctacgtcc
agaatcacgcacgcaactccagcatgctacgcggctcacgtcgagcatcgggacctcgag
gccaagattgctgagcaccagataggatacagccaccccctcggttctgtggtcgatatc
ttgctcggaggtgggagatgctattacgtgcccaaggactctactggttcctgccgtgat
gatgatatcaacctgctcgaattcgctgaagagaaggggttcaatgtcttcacagaccga
gctgggtttgacagcctgcagggtggtgaggaggcgacgctaccatatcttggtcttttt
gccctgaatcacatggcctacgaagtcgaccgcgtagacagcctcgagccctcacttttg
gaaatgacgcagaccgctctgacttcgctcgagaacgccaccaagaactccacgcgaggc
tacttcatcatgatcgaagcctcgcgcatcgaccacgccggccacaacaacgatcccgtc
ggccatctgcacgacacgatccaatacaacgaagtcatggaattcgtgcgcagatgggtc
gacgcccgccccgatacgcagctgatgtctgccgcggatcacgagaccggcggtctcaca
ctcgtgggctacaacccactcgtgctgaaagcagccaactccacctcagagttcctcaac
ggcgagttcacggcctacaacggctcggacccggcctccttcctccggaccaacatcttc
ccggcctacggcatcagcgaccccacggacgccgagatcctgacgctgacccagctgaag
ggcgaggagacgttcaacaatgagctgggcaagatgctgagtacgagagccggcatccag
tggagtaccgacggccactcggctgccgatgtcacgctgtacgggcatagcgagggtcag
gggcaaatgatcctccgccaaaacatggcgggcaactgggacaacacccagctgccgctg
tacctggagaagcagttgcgcctgaacctggcggcggcgacggaggcgttgagagcgaat
gggactgattgggttggacgcgaggccgtgaagcggagatctttgggccaccatgaccac
tag

DBGET integrated database retrieval system