KEGG   Marssonina brunnea: MBM_10021Help
Entry
MBM_10021         CDS       T03105                                 

Definition
(RefSeq) invertase precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mbe  Marssonina brunnea
Pathway
mbe00052  Galactose metabolism
mbe00500  Starch and sucrose metabolism
mbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MBM_10021
   00500 Starch and sucrose metabolism
    MBM_10021
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MBM_10021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18765944
NCBI-ProteinID: XP_007297898
UniProt: K1WHZ2
Position
Unknown
AA seq 575 aa AA seqDB search
MLFQGLALTAALANLAAAQIPSAVAPAAYNAGVPTGTPVPGVYSGQWRPQIHFSPPSNFM
NDPNGCFLDANGTWHLYYQCKSSVTHNPARPEAGNQHWGHATSKDLYTWENQPIALYATE
DTQVFSGSVVTDPNNTSGFFPNQDNGVVAIYTLNTAHEQTQAISYSLDGGYTFVNYTGNP
VLRASPPSSQFRDPKVIWYEDHWVMSIAYSQDFVVGIFTSPDLKNWTHASNFTRMGVLGL
QYECPNLVRMPVLGEEPMWLMVISINPGGPIGGSFTQYFPGTFNGTHFEAVDDAARILDF
TKDNYAGHFFYGVPESEDPVFIAWASNWQYTNEVPTGEREGWRSAMTLPRRAHLIRNATR
SGWVLVGTPYDFTPLLDTQLAVDANLGNGTILSDYSSVSSGTLYFQVNVTGLQRPALGTG
TLNFTFTASSTRESITGGFYFGGTPGNFRYDNPFWVSRHNILGFAETNPFFTNRFSVANI
LNPDGTFTLEGVIDRSMLEIFLDGGRSTGTTLFYPEGVLDTMEVRTRDLNEGVVVSVAVW
GVKSTWAGQASEDGVVYGNVTTVTPTGYAAMPLPQ
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttcaaggacttgcactgactgcggctcttgccaacctggcagctgcacagatt
ccgtcggctgtcgcccctgctgcttataacgctggtgtgccgacgggaacgccggttcct
ggcgtttacagtggtcaatggcgtccccaaatccatttttcaccgccgtcgaacttcatg
aatgaccccaatggctgctttctcgatgccaatgggacatggcatctttactatcaatgc
aagtcttccgtcactcacaacccagcacgtcctgaggccggtaaccaacattggggacat
gccacatccaaagatctctacacttgggagaatcagccaatcgccctttacgcaaccgag
gatacccaggtcttctcgggtagcgttgtcaccgacccaaacaacacttccggcttcttc
ccgaaccaggacaacggtgtagttgctatctacaccctcaacacggcccacgagcagacc
caagccatctcctactccctcgacggtggttacaccttcgtgaactacaccggaaaccct
gtgctcagagccagccctccatcttcccagttcagagaccccaaggtcatctggtacgag
gaccactgggtcatgagtatcgcctactcacaagatttcgtcgttggcattttcacctcc
ccagatcttaagaattggacccatgcctcgaacttcacaaggatgggagttctcggcctc
caatatgaatgccccaacttagtccgcatgcccgttctcggtgaggaaccaatgtggctc
atggtcatcagcatcaaccccggaggaccaattggtggttcctttacccagtatttcccc
ggcactttcaacggcacgcactttgaagccgtcgacgatgcagcccgtatcctcgatttc
accaaggacaactacgccggccatttcttctacggcgtccccgagtccgaggatcccgtc
ttcattgcctgggccagcaactggcaatacaccaacgaggtgcccaccggcgagcgtgaa
ggctggagaagcgcaatgactctcccccggcgagctcacctcatccgtaacgccactcgc
agcgggtgggtactcgtcggaaccccgtacgatttcacgcctctccttgatacacagctg
gccgtcgacgccaacctcggcaacgggaccatcttatcagactactcctccgtgagcagc
gggaccctctacttccaggttaatgtgaccggccttcagcggcccgcgctcgggacagga
acgctgaacttcacgttcacggcttcgtcgacgcgggagtccatcacgggcggcttctac
ttcggcgggacacccggaaacttccgctacgacaacccgttctgggtgtcccgccacaac
atcctgggatttgcggagacgaatcctttcttcacgaatagattcagcgtcgccaacatt
ttgaacccggatggcaccttcacgctagaaggggtcatcgatcgctcgatgctggagatc
ttcctggacggcgggcgcagcactggcacgacgctcttctaccccgaaggcgtgctggat
accatggaggtgaggaccagggatctgaacgagggtgtcgttgttagtgttgccgtctgg
ggggtgaagagcacgtgggccgggcaggcgagtgaggacggggttgtgtatggtaacgtg
acgaccgtcacgccgacgggctacgccgcgatgcccttgccacaatga

DBGET integrated database retrieval system