KEGG   Methanoculleus bourgensis: BN140_0553Help
Entry
BN140_0553        CDS       T02189                                 

Gene name
dhpS
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mbg  Methanoculleus bourgensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mbg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(555190..556005)
Genome map
AA seq 271 aa AA seqDB search
MLQQHCIVDRLRIGAGAPVRLMGIINCSPESFYRGSYTPTGRIYDRALAMQEAGADMIDL
GARSTAPGSVPITVAEEAERVDAALSELDGTGITLSVDTRYPEVLEVCLRHDVHAVNDIS
GLADERYARAVADSGLPVFVMASFREPGDAAGLAETLAALEAVVTRCARLEIDEYVLDPA
VGRWIPERTNEDDWELCRNFEAFLTFGRPVLAAISRKTFIGDLIGKGPEERLAGTLALTM
DLVRQGAAVVRSHDVAETADLLRVYEKMRQT
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaacaacactgtattgtagaccgcctcaggatcggcgccggagcgccagttcgc
ctgatgggcatcatcaactgcagccccgagtcgttctaccggggctcctataccccgacc
gggaggatatacgaccgcgcccttgccatgcaagaagcgggggccgacatgatcgacctc
ggggcgcggagcacggctccgggttcggtccccatcaccgtcgctgaagaggcggaacgg
gtggatgcagcgctctcagaactcgacgggaccgggatcaccctctcggtggatacccgc
tacccggaggtgctcgaggtctgcctccgccacgacgtccacgcggtgaacgacatctcg
gggctcgccgacgagcgctacgcgcgggcggtcgcagactccgggttgccggtctttgtg
atggcaagtttcagggaaccgggcgatgccgccgggcttgccgaaacactcgcggcactc
gaggcggtcgtgacgcggtgcgcgcgccttgagatcgacgaatacgtccttgaccctgcc
gtcgggagatggatcccggaacggacaaacgaggatgactgggagctctgccggaacttt
gaggcgttcttaaccttcggccgcccggtgctcgccgcgatctcccgaaagaccttcatc
ggagacctgatcggaaaaggaccggaagagcggctcgcgggaaccctcgcgctcaccatg
gacctggtcaggcagggagcggccgtggtcaggagccacgacgtcgccgagactgcagac
ctgctcagggtgtatgagaagatgagacagacatga

DBGET integrated database retrieval system