KEGG   Methanoculleus bourgensis: BN140_0687Help
Entry
BN140_0687        CDS       T02189                                 

Gene name
thrC3
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN140_0687 (thrC3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN140_0687 (thrC3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN140_0687 (thrC3)
Enzymes [BR:mbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN140_0687 (thrC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715650..716852
Genome map
AA seq 400 aa AA seqDB search
MYRLVCVHCAATYAPDQIIYTCKHCGHLLTVEYDLDGIDVSREEWDRRPLSVWRYREILP
VQGEPVSLQEGGTPLYHLEKIGKELGLPELYAKHEGMNPTGSFKDRGMTVGVSMARQLGM
TSVACASTGNTSASLAAYAAKASIPCVVLLPAGKVALGKVAQALMHGARVISIRGNFDRA
LEMVHELCISHGLYLLNSVNPYRLEGQKTIGFEAIDQLGDVPDRIVLPVGNAGNISAVYK
GLRELEALGFIDRLPMMTGIQAAGSQPVVKAIEQNLDELVPEPAPETVATAIRIGAPVNA
EKALVAIRATGGTAAAVTDDEILRMQQDLARMEGIGVEPASAASVAGIRKLAEQGLIDKD
ERIVCVVTGHLLKDPETVVRQCEPPIEIDADLHSLLSVLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctcgtctgcgttcactgtgctgcgacctacgcaccggaccagatcatctat
acgtgtaaacactgcggacacctgctgaccgtcgagtacgacctggacggcatcgacgtc
tcccgggaagaatgggaccgccgccccctctcggtctggcgctaccgcgagatcctcccg
gtgcagggcgaaccagtctccctccaggaaggaggcacaccgctttaccacttagaaaag
attggaaaagaactgggactccccgagctctacgccaaacacgagggtatgaacccgacc
ggctcgttcaaggaccggggcatgaccgtgggcgtcagcatggcccgccagctcgggatg
acgagcgtcgcctgtgcaagcaccgggaacacctccgcaagcctcgctgcctacgcggcg
aaggccagcatcccctgcgtcgtcctcctgcccgccgggaaggtggcgctcggcaaggtc
gcccaggcgctgatgcacggcgcacgggtcatctccatccgcggcaactttgatcgagcg
cttgagatggtacacgaactctgtatcagccacggtctctacctcttaaactcggtcaac
ccctaccgcctggaagggcagaagacgatcgggtttgaggcgatcgaccagctcggcgat
gtgcctgaccggattgttctcccggtcggaaacgccggcaacatctctgcggtctacaag
ggactccgggagcttgaggcgctcgggttcatcgaccggctgccgatgatgactgggatc
caggcagcaggctcacagccggtggtgaaggcgatagagcagaacctcgatgaactggtt
cctgagccggcaccagagactgttgcaaccgcgataaggatcggcgccccggtgaacgcc
gagaaggcgctcgtcgctatccgcgcgaccggcgggacggcggcggccgtgaccgacgac
gagatccttcgcatgcagcaggaccttgcgaggatggaagggatcggggtcgagcctgcc
tccgctgcctcggtcgccgggatacggaaacttgccgaacagggattgatcgataaagac
gagcggatcgtctgtgtggtgaccggccacctcttaaaggatcccgaaacagtggtacga
caatgcgaaccccccatcgagatcgacgcggacctgcactccttgctctctgtcttgcgc
tga

DBGET integrated database retrieval system