KEGG   Methanoculleus bourgensis: BN140_0691Help
Entry
BN140_0691        CDS       T02189                                 

Gene name
porB
Definition
pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mbg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mbg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mbg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mbg00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mbg00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mbg00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mbg00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(719309..720220)
Genome map
AA seq 303 aa AA seqDB search
MADVEQGCELFSAGHRACGGCGPALAARLLLKATGKNVIIAASTGCMEVFSTPYPETAWG
VPWIHSLFENVAAVASGIEASLKKQGRSEKVVCIAGDGATFDIGVLCISGAFERGHDITY
ICYDNEAYMNTGIQRSGATPYGASTTTSPAGACAPGGNPLPKKDMPAILAAHGAPYVATA
SIAYPNDFIKKVERAINTPGPCYIQVHTPCCTGWGFESGETLAMAKLAIETGLWVNYEMV
NGVVEKAKKVRRKPVEEYLAKQKRFRHLFRPARLDAEIAKIQAIADANAERFGIDIKVKE
PSE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtagagcagggatgcgagctcttctcggcaggacaccgggcgtgcgggggg
tgcggaccggcgcttgcggcccgcctcctcctcaaggcgaccggaaagaacgtcatcatc
gccgcctcgacggggtgcatggaggtcttctccacgccctatcccgagacagcgtggggg
gtcccctggatccactcgctcttcgagaacgttgcagcggttgcgtcgggcatcgaggcg
tcgctgaagaagcaggggcgcagcgagaaggtcgtctgtatcgccggcgacggcgccacg
ttcgatatcggggtgctctgtatcagcggcgccttcgagcgtggtcacgatatcacctac
atctgctacgacaacgaggcctacatgaacacagggatccagcggtcgggtgcgacgccc
tatggcgcaagcaccaccacgagcccggcgggggcgtgcgcgcccgggggcaacccgctc
ccgaagaaggatatgcccgcgatcctcgctgctcacggtgcgccctatgtggcgaccgcc
tcgatcgcctacccaaacgacttcataaagaaggtcgagcgcgcgatcaacacccccggc
ccctgttacatccaggtgcacactccctgctgcacgggatggggctttgagtccggggag
acgctcgccatggccaaactcgccatcgagacaggtctctgggtgaactacgagatggtc
aacggtgtggtggagaaggcaaagaaggtgaggcgcaagcctgtcgaggagtacctcgcg
aaacagaagcgcttccggcacctcttcaggcccgcccggcttgatgctgagatcgcaaag
atccaggcgatcgctgatgcgaacgcagagcggttcgggatcgatatcaaggtgaaggaa
ccctcagaataa

DBGET integrated database retrieval system