KEGG   Methanoculleus bourgensis: BN140_0692Help
Entry
BN140_0692        CDS       T02189                                 

Gene name
porA1
Definition
pyruvate ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_0692 (porA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_0692 (porA1)
   00020 Citrate cycle (TCA cycle)
    BN140_0692 (porA1)
   00620 Pyruvate metabolism
    BN140_0692 (porA1)
   00640 Propanoate metabolism
    BN140_0692 (porA1)
   00650 Butanoate metabolism
    BN140_0692 (porA1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0692 (porA1)
   00680 Methane metabolism
    BN140_0692 (porA1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_0692 (porA1)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_0692 (porA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720221..721375)
Genome map
AA seq 384 aa AA seqDB search
MMEIMEGSHAVAEIVKRCRPQVVSAYPITPQTHIVEDLAQMVANCELDAEYITVESEFSA
LSACLGASAAGSRVYSATTSQGLALMFEVCFNVAGMRQPIVMTIANRSLGAPLSIWNDQQ
DSISLRDSGWLQFYAEDNQEAADLHMIAYKVCEDHDVLLPAFVCFDGFILSHTYEPVDLP
SQEEVDAYLPAFTPYQRLDAEEPLSFGMYATPEYYMEFRYEIDQAMRRAKEAFIRAGREF
GEQFGRDYSALVEGYRLDDADTALVAMGSICGTAKDAVDEMRDAGRKVGLLKIRTYRPFP
GPEIAEALKGVSTVAVLDKNISLGNGGAVGTEVKSALYGSGAAVYDYIIALGGRDVRKRD
IAAVVDLAEKGEGDMFYGLRTEVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatggagattatggaaggatcgcatgcggtggccgagatcgtgaaacgctgccgcccg
caggtggtctctgcctacccgatcacgccacagacgcacatcgtcgaggatcttgcccag
atggtggcgaactgtgaactcgacgccgaatacatcacggtcgagagcgagttctcggcc
ctctccgcctgcctcggcgcgagcgcggcaggttcccgggtctactcggcaacgacctcc
cagggcctcgccctgatgttcgaggtctgcttcaacgtggcggggatgcgccagccgatc
gtgatgacgatcgcgaaccgctctcttggcgcgccgctctcgatctggaacgaccagcag
gactcgatatccctgcgcgactccgggtggctgcagttttacgctgaggataaccaggaa
gccgccgatctccacatgatcgcctataaggtctgtgaagaccacgacgtcctcctgccg
gcgtttgtctgtttcgacgggttcatcctctcgcacacctacgagccggtcgacctcccc
tcgcaggaggaggtggacgcctacctgcccgccttcacaccctaccagcggctggatgct
gaggagccgctgagctttgggatgtacgcgacgcccgagtactacatggagttcaggtac
gagatcgaccaggcgatgcgccgcgctaaagaggcgttcatcagggcgggccgcgagttc
ggcgagcagttcgggagggactactctgcccttgtggagggttacaggctcgatgacgcc
gataccgcgctcgttgccatgggctccatctgcggcacggcaaaagacgctgtcgacgag
atgcgcgatgccggccggaaggtaggactcttgaagatccggacttaccggccgttcccg
ggccctgagatcgcagaggcgctcaaaggtgtctcgacggtggcggtgctcgacaagaac
atatcgctcgggaatggcggagcggtcggcaccgaggtgaaatcggcactctacggttcc
ggtgcggccgtctacgactatatcatcgctctcggcgggcgcgatgtgcgcaaacgcgat
atcgccgcggtcgtcgacctcgccgagaagggagaaggagatatgttttacggattacgg
acggaggtgctctga

DBGET integrated database retrieval system