KEGG   Methanoculleus bourgensis: BN140_0693Help
Entry
BN140_0693        CDS       T02189                                 

Gene name
porD1
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00020  Citrate cycle (TCA cycle)
mbg00620  Pyruvate metabolism
mbg00633  Nitrotoluene degradation
mbg00640  Propanoate metabolism
mbg00650  Butanoate metabolism
mbg00680  Methane metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_0693 (porD1)
   00020 Citrate cycle (TCA cycle)
    BN140_0693 (porD1)
   00620 Pyruvate metabolism
    BN140_0693 (porD1)
   00640 Propanoate metabolism
    BN140_0693 (porD1)
   00650 Butanoate metabolism
    BN140_0693 (porD1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0693 (porD1)
   00680 Methane metabolism
    BN140_0693 (porD1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_0693 (porD1)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_0693 (porD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_16 Fer4_9 Fer4_8 Fer4_13 Fer4_17 Fer4_4 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-GeneID: 13354425
NCBI-ProteinID: CCJ35616
UniProt: I7KBT2
Position
complement(721375..721635)
Genome map
AA seq 86 aa AA seqDB search
MALRIGCAAPPGRALENKTGAWRVFKPVFDPETCSRCGMCALVCPEGCVHETEEGTFEPD
LDYCKGCGICEEVCPKKSIRMEKEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtggcactgcgaatcggctgtgccgcgcccccgggcagggcacttgagaataagaccggc
gcctggcgggtcttcaaaccggtctttgatcctgagacctgcagccggtgcggcatgtgc
gccctggtatgccctgaagggtgtgtccacgagaccgaggaggggacgtttgagcccgac
ctcgactactgcaaggggtgcggcatctgcgaagaggtctgcccgaagaaatcgatccgg
atggagaaggaggagaaataa

DBGET integrated database retrieval system