KEGG   Methanoculleus bourgensis: BN140_0694Help
Entry
BN140_0694        CDS       T02189                                 

Gene name
porG
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00020  Citrate cycle (TCA cycle)
mbg00620  Pyruvate metabolism
mbg00633  Nitrotoluene degradation
mbg00640  Propanoate metabolism
mbg00650  Butanoate metabolism
mbg00680  Methane metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_0694 (porG)
   00020 Citrate cycle (TCA cycle)
    BN140_0694 (porG)
   00620 Pyruvate metabolism
    BN140_0694 (porG)
   00640 Propanoate metabolism
    BN140_0694 (porG)
   00650 Butanoate metabolism
    BN140_0694 (porG)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0694 (porG)
   00680 Methane metabolism
    BN140_0694 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_0694 (porG)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_0694 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-GeneID: 13355226
NCBI-ProteinID: CCJ35617
UniProt: I7LJ43
Position
complement(721635..722180)
Genome map
AA seq 181 aa AA seqDB search
MRELRIHGRGGQGSVTAAELIAFAAFEGGVYAQAFPAFGVERRGAPVQAFVRFSDEKIRL
RSQVYEPDYIIVQDPTLIGDVDVFMGMEAGGIAIVNTEKPDFDANVPEGVKVYTIDATTI
ALEELGVPITNTTLMGAFAAATGEIKLESLEHALRNRFSGSMADKNVRAAERAYNLIGGA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgagagagttacgaatccatgggaggggcggtcagggttccgtgaccgccgccgagctc
atcgctttcgcagcatttgaggggggcgtgtatgcccaggcgttccctgccttcggtgtg
gagcgacggggtgccccggtgcaggcgttcgtccgtttcagtgacgaaaagatccggttg
cgcagccaggtctacgagcctgactacatcatcgtgcaggacccgaccctgatcggggat
gtcgacgtctttatgggcatggaagcgggcggcatcgccatcgtcaacaccgagaagccc
gactttgatgccaacgtcccggagggcgtgaaggtctataccatcgatgcgaccaccatc
gcgctcgaggaactgggcgtgcccatcaccaatacaaccctgatgggcgcgttcgccgca
gccacaggcgagatcaaactcgaatccctggaacacgcactgcggaaccggttctcgggg
agtatggcagataagaacgtcagggcggcagagcgcgcgtacaacctgatcggaggtgct
gcgtag

DBGET integrated database retrieval system