KEGG   Methanoculleus bourgensis: BN140_0892Help
Entry
BN140_0892        CDS       T02189                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mbg  Methanoculleus bourgensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_0892 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN140_0892 (sucC)
   00640 Propanoate metabolism
    BN140_0892 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN140_0892 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0892 (sucC)
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN140_0892 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935136..936221)
Genome map
AA seq 361 aa AA seqDB search
MKLLEYEAKEIFSKYGIPVPKGVLIRAPEEVTAHLPRIGDAVVLKAQVDVGGRGKAGGVL
MAEDATAVETARELFSREIKGVPVRSILVEERLAIEHEYYVSIAVDRSSRQPVVLFADAG
GVEIENAAMADESAVRRVVVSPLLRDIPPFLMRELLGGAPKELAPTINSLYHAFQEKDAM
LAEINPLVTTPQGVYAADAKLIIDDNALARQGIAVNRDLSEREREAEKHGFSYVELDGSI
GVIGNGAGLTMSTLDLIEYYRGQAANFLDVGGGADQERVMHAVRLVASMPGVNVIVVNLL
GGITRCDEVAKGIIAAGVAPTVIVRMAGTNEEEGRQLLAEHGYRMLESMDAAVRAAMEVA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactggaatacgaggcaaaagagatcttttcgaagtacggcattccggtcccg
aaaggggttctgatacgggcaccggaagaggtcacggcacacctgcccaggatcggcgat
gccgtggtgctgaaggcgcaggtggacgtcggcggacgggggaaggcaggcggcgtcctg
atggcagaggacgcgacggcggtcgagaccgcccgggaactcttctcccgggagatcaag
ggtgtcccggtcaggagcatcctcgtcgaggagaggctcgcaatcgagcacgagtactac
gtcagcatcgccgtcgaccggtcgagcagacagccggtggtcctcttcgccgacgcaggc
ggggtggagatcgagaacgcggcgatggccgacgagtcagccgtccgcagggtcgtcgtg
tcgccgcttctccgggacatcccgccgtttctcatgcgggaactcctcggcggagcccca
aaagaacttgcacccacaataaacagtctctaccacgcgttccaggagaaggacgctatg
cttgcggagatcaacccgctcgtgacgacgccgcagggagtctacgcggccgacgcaaaa
ctcatcatcgacgacaacgccctcgcccggcaggggatagcggtcaaccgcgacctctcg
gaacgcgagcgtgaggccgagaagcacggcttctcctacgtggaactggacggaagcatc
ggtgtcataggaaacggcgccgggctcacgatgtcgacgctcgacctcatcgagtactat
cggggacaggcagcaaacttcctcgatgtcggcggcggcgccgaccaggagcgcgtgatg
cacgcagtcaggctcgtcgcgagcatgcccggggtgaacgtgatcgtggtcaacctcctc
gggggcatcacccggtgcgacgaggtggcgaagggaatcatcgccgccggcgtcgcaccg
acggtcattgtccggatggccgggacgaacgaggaggaaggacggcaactgctcgccgag
cacggctaccggatgctcgagagcatggatgcggctgtccgggcggcgatggaggttgca
gcatga

DBGET integrated database retrieval system