KEGG   Methanoculleus bourgensis: BN140_1119Help
Entry
BN140_1119        CDS       T02189                                 

Gene name
manB
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1119 (manB)
   00030 Pentose phosphate pathway
    BN140_1119 (manB)
   00051 Fructose and mannose metabolism
    BN140_1119 (manB)
   00052 Galactose metabolism
    BN140_1119 (manB)
   00500 Starch and sucrose metabolism
    BN140_1119 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    BN140_1119 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    BN140_1119 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN140_1119 (manB)
Enzymes [BR:mbg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BN140_1119 (manB)
    5.4.2.8  phosphomannomutase
     BN140_1119 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154102..1155463
Genome map
AA seq 453 aa AA seqDB search
MRNGKQMFGTNGVRGVVGEMMTPTLVLKIGAALGSMRNGTIAVGRDTRTSGEALAHALKA
GLLMTGCDVVDMGVLPTPALQYIIKTDDRFAGGAMITASHNPPEYNGVKIIEADGTEMAD
DEIIRLEDRFFAGEFDAAAWDGVGTETAAPDRLEEYIQAVVGHFPAGIGKDMTVVVDPGS
GPAALTTPAILERMGCRVHTINARLDGTFPGRMPEPTPEGLQPLSEMVIATGADFGVAHD
GDADRAVFVDNKGRYIEENYEFGLIEDYVCSRNRGGLVVTPVATSRLIRDIAGKHGCTVD
YTPVGSIYVARRMIELIGQGKNVSFGGEGNGGLIYSDHQFCRDGGMTAAMMVAVLASHNG
RDLSDIIDELPVYHLVKEKYHAPDPAALVRAVEEALPEETIEKIDGIKIIRDDAWALVRA
SGTEPMIRIMVESKDPGVADTMYREIMQVVRQA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacgggaaacagatgtttggaacaaacggcgtccgcggcgtggtcggggagatg
atgacgccgaccctcgtcctcaagatcggcgccgcgctcggatcgatgcggaacggaacc
atcgccgtcggcagggatacaaggacgtccggcgaagccctggcccacgccctcaaggcc
gggctcctgatgaccgggtgcgacgtggtggacatgggcgtcctccccacaccggccctg
cagtacatcataaagaccgatgaccggtttgccggcggcgcgatgatcaccgcgtcccac
aaccctcccgaatacaacggtgtcaagatcatcgaggccgacggcactgagatggcagac
gacgagatcatcaggctcgaagaccggttcttcgccggcgagttcgacgcggctgcctgg
gacggcgtcggcacagagaccgccgcacccgaccggctcgaggagtatatccaggcagtc
gtggggcacttcccggcaggcatcggcaaggacatgaccgtcgtcgtcgaccccggttcc
ggccccgcggccctcaccacacccgccatcctcgagaggatgggctgccgggtccatacc
atcaacgcccggctcgacggcaccttcccgggccggatgcctgaaccgacccccgaaggg
ctgcagcctctctcggagatggtcatcgccacaggcgccgacttcggggtggcgcacgac
ggcgacgccgaccgggcggtctttgttgataacaaaggacgctatatagaagagaactat
gagttcggcctgatcgaggactacgtctgcagcaggaaccgcggcgggctcgtcgtcacc
ccggtcgccacctcccggctgatccgggacattgccgggaagcacgggtgcaccgtcgac
tacacccccgtcgggagcatctacgtcgcaaggcggatgatcgagctcatcgggcagggg
aagaacgtctccttcggcggcgaaggaaacggcggcctgatctattccgaccaccagttc
tgccgggacgggggcatgactgccgcaatgatggtagcggttcttgcaagccataatggg
agagacctctccgatatcatcgacgaactcccggtctaccacctggtcaaggagaagtat
cacgcccctgacccggccgcgctggtccgtgccgtcgaggaagcgctcccggaagagacc
atcgagaagatcgacggtatcaagatcatcagggacgacgcctgggccctggtgcgggcg
tcgggcacggaaccgatgatcaggattatggtcgagtcaaaggacccgggcgtcgcagat
accatgtaccgggagatcatgcaggtggtcaggcaggcctga

DBGET integrated database retrieval system