KEGG   Methanoculleus bourgensis: BN140_1158Help
Entry
BN140_1158        CDS       T02189                                 

Gene name
argE
Definition
Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mbg  Methanoculleus bourgensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN140_1158 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BN140_1158 (argE)
Enzymes [BR:mbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BN140_1158 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1193357..1194526
Genome map
AA seq 389 aa AA seqDB search
MDVARLTSSLVRIRSENPPGKTADVVEYIREFLDSLGVKCRVIPHPGGRDNLITTEPDPR
ILLCGHVDVVPAIPDDWTHDPYGGEIAGGYVWGRGATDMKGGCAALLAAYRDLIESGVEP
KAQFAFVCDEETGGPYGIRSLLAQNLLLPRDCLIAEPTPPTSPAAGQKGLYRIDLSFRGR
PGHSSLYPMVGKSAVMAAFDLLGYLREVHAHPFPVGEDLQPLIAQSARVFHEVFGLEGVD
DVLTRVMFNPGRIEGGEKANIVAEQCRMELDIRVPWGCPLDDLKKGIAAHAPDATIREMD
VAEPTLTPPDSRIVRTVCREVERVYGRPAVPLLQWAASDAKYLRTEGFDVVEYGPGEITT
LHAVDERVSVEQLEKAVDVYRGVIRGYSG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgcccgcctcacctcatcgctcgtccggatcaggagcgagaacccgccgggg
aagacggccgatgtggtcgagtatatcagggaattcctcgactcgcttggggtgaagtgc
cgcgtcatcccccacccgggcgggcgggacaacctcatcacgaccgaacctgatccgcgg
atcctcctctgcggccacgtggatgtggtcccggccatccccgatgactggacgcacgac
ccctacggcggcgagatcgccggtggttacgtctgggggaggggtgccaccgatatgaaa
ggcgggtgcgctgcccttcttgccgcctaccgggacctcatcgagagtggtgtggagcca
aaggctcagtttgcctttgtctgtgatgaggagaccggcggcccgtatggtatccggtcg
ttgcttgcacagaaccttcttctgccccgcgactgcctgatagccgaaccgacgcctccg
acgagcccggcggccggccagaaaggtctctaccggatcgatctctccttccgcggcagg
ccgggccatagttctctctatcctatggtcgggaagagcgccgtcatggcggcgtttgac
ctgctcgggtacctgcgggaggtccatgcgcacccgttccctgtcggcgaagacctgcaa
ccgctcattgcacagtctgcccgggtcttccatgaggtcttcgggcttgagggggtggac
gacgtcctcacccgggtgatgttcaacccggggcgcatcgagggcggagagaaggcgaac
atcgtggctgagcagtgccggatggaactggatatccgggtgccctgggggtgtcccctc
gacgacctgaagaagggcatcgccgcgcatgccccggacgccaccatacgcgagatggat
gtcgccgaaccgacactgacccccccggacagccggatcgtccggacggtctgccgcgag
gtggagcgggtctacggcaggccggcggtgccgctcctccagtgggcggcaagcgacgcg
aagtacctccgcacggagggctttgatgtcgtggagtacgggccgggggagatcacgacg
ttgcacgcggtggatgagcgggtttctgtggagcaactcgagaaggcggtggatgtgtac
cggggggtgatcagggggtattcggggtag

DBGET integrated database retrieval system